Basic Information | |
---|---|
Species | Selaginella moellendorffii |
Cazyme ID | 59691 |
Family | CBM43 |
Protein Properties | Length: 79 Molecular Weight: 8691.74 Isoelectric Point: 7.848 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 1 | 79 | 8.7e-29 |
WCIAQRRASLAQLQVALDWVCGPGQADCTNIMAGQPCFLPDNSRGHASYAFNNYYLKNNKAYGSCNFSFLATVTTHDPS |
Full Sequence |
---|
Protein Sequence Length: 79 Download |
WCIAQRRASL AQLQVALDWV CGPGQADCTN IMAGQPCFLP DNSRGHASYA FNNYYLKNNK 60 AYGSCNFSFL ATVTTHDPS |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 7.0e-16 | 1 | 72 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-28 | 1 | 79 | 79 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAO42272.1 | 4e-22 | 1 | 79 | 202 | 280 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_565269.1 | 8e-23 | 1 | 79 | 360 | 438 | glycosyl hydrolase family 17 protein / beta-1,3-glucanase, putative [Arabidopsis thaliana] |
Swiss-Prot | O65399 | 5e-22 | 1 | 79 | 272 | 350 | E131_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 1; AltName: Full=(1- |
RefSeq | XP_002312452.1 | 5e-22 | 1 | 79 | 341 | 419 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002321180.1 | 1e-22 | 1 | 79 | 29 | 107 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.000000002 | 1 | 79 | 13 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FD542262 | 79 | 1 | 79 | 3e-24 |
FD542262 | 79 | 1 | 79 | 3e-24 |
FD583887 | 79 | 1 | 79 | 4e-24 |
FD583887 | 79 | 1 | 79 | 4e-24 |
EV214670 | 79 | 1 | 79 | 5e-24 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|