Basic Information | |
---|---|
Species | Selaginella moellendorffii |
Cazyme ID | 59752 |
Family | CBM43 |
Protein Properties | Length: 84 Molecular Weight: 9229.3 Isoelectric Point: 5.5421 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 5 | 83 | 1.5e-30 |
WCIAKPDSPEEALQKALDYACGQPLVNCLQIQPGNGCYSPVNLHSHSSFAMNLYYQGYGKNSWNCNFSGIGILTTADPS |
Full Sequence |
---|
Protein Sequence Length: 84 Download |
DERTWCIAKP DSPEEALQKA LDYACGQPLV NCLQIQPGNG CYSPVNLHSH SSFAMNLYYQ 60 GYGKNSWNCN FSGIGILTTA DPSK |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 5.0e-20 | 4 | 76 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 2.0e-31 | 4 | 83 | 80 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAC83956.1 | 1e-22 | 2 | 84 | 389 | 471 | putative beta-1,3-glucanase [Oryza sativa Japonica Group] |
RefSeq | NP_001151529.1 | 9e-24 | 3 | 83 | 363 | 443 | LOC100285163 [Zea mays] |
RefSeq | XP_001761806.1 | 2e-23 | 3 | 83 | 371 | 451 | predicted protein [Physcomitrella patens subsp. patens] |
RefSeq | XP_002320265.1 | 5e-23 | 2 | 83 | 45 | 126 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002448791.1 | 2e-23 | 3 | 83 | 377 | 457 | hypothetical protein SORBIDRAFT_06g033250 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 6e-20 | 4 | 83 | 12 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
AM768366 | 82 | 2 | 83 | 8e-26 |
AM768366 | 82 | 2 | 83 | 8e-26 |
AM769521 | 82 | 2 | 83 | 1e-25 |
AM769521 | 82 | 2 | 83 | 1e-25 |
AM771747 | 82 | 2 | 83 | 2e-25 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |