Basic Information | |
---|---|
Species | Selaginella moellendorffii |
Cazyme ID | 69709 |
Family | CBM43 |
Protein Properties | Length: 68 Molecular Weight: 7505.39 Isoelectric Point: 5.5454 |
View CDS |
External Links |
---|
NCBI Taxonomy |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 2 | 65 | 7.2e-23 |
WCIANSSIRSYAFEVALGETCQKIDCSAIREGGECFSPNTLPWHASYAFNLYFQNNGRTLAACH |
Full Sequence |
---|
Protein Sequence Length: 68 Download |
EWCIANSSIR SYAFEVALGE TCQKIDCSAI REGGECFSPN TLPWHASYAF NLYFQNNGRT 60 LAACHALG |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 2.0e-12 | 2 | 64 | 69 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 8.0e-19 | 2 | 64 | 64 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 0.0000000002 | 1 | 59 | 12 | 71 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |