| Basic Information | |
|---|---|
| Species | Selaginella moellendorffii |
| Cazyme ID | 75468 |
| Family | GH1 |
| Protein Properties | Length: 105 Molecular Weight: 12170.5 Isoelectric Point: 4.1954 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 1 | 102 | 7.1e-40 |
| WIYVVPWGLYNILSHVKENHNNPPIFITENGLVDVADSNTFSDRFIKDDARVQFYESYLTSLQQAIANGVDVRGYYAWSLLDNWEWDSGFSQRFGLYYVD YS | |||
| Full Sequence |
|---|
| Protein Sequence Length: 105 Download |
| WIYVVPWGLY NILSHVKENH NNPPIFITEN GLVDVADSNT FSDRFIKDDA RVQFYESYLT 60 SLQQAIANGV DVRGYYAWSL LDNWEWDSGF SQRFGLYYVD YSAL* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PRK13511 | PRK13511 | 2.0e-21 | 1 | 101 | 104 | + 6-phospho-beta-galactosidase; Provisional | ||
| PLN02814 | PLN02814 | 6.0e-25 | 5 | 102 | 98 | + beta-glucosidase | ||
| COG2723 | BglB | 3.0e-26 | 6 | 101 | 98 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| pfam00232 | Glyco_hydro_1 | 9.0e-33 | 1 | 101 | 101 | + Glycosyl hydrolase family 1. | ||
| TIGR03356 | BGL | 4.0e-33 | 4 | 101 | 98 | + beta-galactosidase. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABR25480.1 | 2e-31 | 1 | 104 | 46 | 147 | non-cyanogenic beta-glucosidase precursor [Oryza sativa Indica Group] |
| GenBank | ACN27151.1 | 3e-31 | 1 | 102 | 21 | 122 | unknown [Zea mays] |
| GenBank | ACR37999.1 | 4e-31 | 1 | 101 | 400 | 501 | unknown [Zea mays] |
| EMBL | CBI23349.1 | 5e-31 | 1 | 101 | 207 | 307 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002265653.1 | 3e-31 | 1 | 101 | 194 | 294 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3f5l_B | 1e-31 | 1 | 104 | 363 | 464 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
| PDB | 3f5l_A | 1e-31 | 1 | 104 | 363 | 464 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
| PDB | 3f5k_B | 1e-31 | 1 | 104 | 363 | 464 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
| PDB | 3f5k_A | 1e-31 | 1 | 104 | 363 | 464 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
| PDB | 3f5j_B | 1e-31 | 1 | 104 | 363 | 464 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FE451033 | 104 | 1 | 104 | 0 |
| FE499889 | 104 | 1 | 104 | 0 |
| FE502549 | 104 | 1 | 104 | 0 |
| FE506926 | 104 | 1 | 104 | 0 |
| FE499084 | 104 | 1 | 104 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Selaginella moellendorffii | 408050 | 73365.202.440 | 73365.202.440 | ||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |