y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis lyrata
Cazyme ID858221
FamilyGH9
Protein PropertiesLength: 621 Molecular Weight: 69139.8 Isoelectric Point: 9.18
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH91085830
  NYTIALPIALKFFNAQQSGKLPKNNNSVKWRGDSCLQDGKGDPGQYYKDLVGGYYDAGDSIKFNFPMSYAMTMLSWSVIEYSAKYEAAGELDHVKELIKW
  GTDYFLKTFNSSADIIYEMVEQVGSGVSGGGSVLHNDHYCWMRPEDIHYKRIVYQCYSSCSDLAAEMAAALASASIVLKDNRLYSEKLVHGAKTLYKFAT
  FNKNRYSTPGKESSKFYNSSMYEDELLWGGAWLYYATGNVTYLEGVTSHYMAKKAGAFGNSPYYGVFSWDNKLPGAQLLLTRMRLFLSPGYPYEELLSAF
  HNQTGRVMCSYLPYYKKFNRTSGGLIQLNHGAPQPLQYVANAAFLAALFSDYLDAADTPGWYCGPNFYTTELLRDFSRSQIDYILGKNPRKMSYVVGYGQ
  RYPKQVHHRGASIPKNKRETCTGGLKWKKSKKGNPNTIDGAMVAGPDKHDGFHDVRSNYNYTEPTLAGNAGLVAAL
Full Sequence
Protein Sequence     Length: 621     Download
MYGRDPWGGP LEINAADSLT DDDRSRNLQD LDRATPSRPL DETQQSWLLG PKVLKKKKYV    60
DLGCILVSRK IFLWTLGIIV VTALLSGFIT LIVKTLPHHK PKKPPLDNYT IALPIALKFF    120
NAQQSGKLPK NNNSVKWRGD SCLQDGKGDP GQYYKDLVGG YYDAGDSIKF NFPMSYAMTM    180
LSWSVIEYSA KYEAAGELDH VKELIKWGTD YFLKTFNSSA DIIYEMVEQV GSGVSGGGSV    240
LHNDHYCWMR PEDIHYKRIV YQCYSSCSDL AAEMAAALAS ASIVLKDNRL YSEKLVHGAK    300
TLYKFATFNK NRYSTPGKES SKFYNSSMYE DELLWGGAWL YYATGNVTYL EGVTSHYMAK    360
KAGAFGNSPY YGVFSWDNKL PGAQLLLTRM RLFLSPGYPY EELLSAFHNQ TGRVMCSYLP    420
YYKKFNRTSG GLIQLNHGAP QPLQYVANAA FLAALFSDYL DAADTPGWYC GPNFYTTELL    480
RDFSRSQIDY ILGKNPRKMS YVVGYGQRYP KQVHHRGASI PKNKRETCTG GLKWKKSKKG    540
NPNTIDGAMV AGPDKHDGFH DVRSNYNYTE PTLAGNAGLV AALVALSGEK PVGGIDKNTM    600
FSAVPPLPMA TPPPPAPWTP *                                              660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00119PLN001195.0e-10573571510+
PLN02171PLN021719.0e-107108572476+
PLN02340PLN023408.0e-109108572479+
PLN02345PLN023455.0e-133112572470+
pfam00759Glyco_hydro_92.0e-150108572474+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK59818.1016041605AT5g49720/K2I5_8 [Arabidopsis thaliana]
GenBankAAN72232.1016041605At5g49720/K2I5_8 [Arabidopsis thaliana]
EMBLCAB51903.1016041605cellulase; endo-1,4-beta-D-glucanase [Brassica napus]
RefSeqNP_194157.1016091609ATGH9A3 (ARABIDOPSIS THALIANA GLYCOSYL HYDROLASE 9A3); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
RefSeqNP_199783.1016041605ATGH9A1 (ARABIDOPSIS THALIANA GLYCOSYL HYDROLASE 9A1); cellulase/ hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A01085864428A Chain A, Crystal Structure Of The R3 Form Of Pectate Lyase A, Erwinia Chrysanthemi
PDB1ksc_A01085864428A Chain A, Crystal Structure Of The R3 Form Of Pectate Lyase A, Erwinia Chrysanthemi
PDB1ks8_A01085864428A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2xfg_A0965869459B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB4tf4_B01055892443B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
Transmembrane Domains
StartEnd
7193
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BF01044460716040
HO794674570376040
HO7962134761326040
HO778339454424940
HO7783391124946040
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00010.1Aquca_058_00008.1Aquca_014_00010.2Aquca_014_00403.1
Arabidopsis lyrata495032894138
Arabidopsis thalianaAT5G49720.1AT4G24260.1AT1G65610.1
Brachypodium distachyonBradi1g09460.1Bradi1g63560.1Bradi5g14580.1
Brassica rapaBra000594Bra040496Bra019237Bra013781Bra022470
Bra016970Bra039767
Carica papayaevm.model.supercontig_17.23evm.model.supercontig_88.37evm.model.supercontig_151.55evm.model.supercontig_49.52
Capsella rubellaCarubv10027986mCarubv10004382mCarubv10019972m
Citrus clementinaCiclev10000600mCiclev10014583mCiclev10024241mCiclev10003884mCiclev10003122m
Citrus sinensisorange1.1g007014morange1.1g007041morange1.1g013516morange1.1g046335morange1.1g013288m
orange1.1g041590morange1.1g043321m
Cucumis sativusCucsa.260330.1Cucsa.178750.1Cucsa.212770.1
Eucalyptus grandisEucgr.G00035.1Eucgr.A00393.1Eucgr.G00035.2Eucgr.F02731.1
Fragaria vescamrna29283.1-v1.0-hybridmrna25126.1-v1.0-hybrid
Glycine maxGlyma09g02160.1Glyma15g13080.1Glyma17g00710.1Glyma07g40090.1Glyma20g06820.1
Glyma06g12910.2Glyma06g12910.3Glyma04g41891.1
Gossypium raimondiiGorai.011G089500.1Gorai.010G143300.1Gorai.010G143300.2Gorai.008G141900.1Gorai.010G143300.3
Gorai.011G089500.2Gorai.003G089600.1Gorai.003G089600.2Gorai.003G089600.3
Linum usitatissimumLus10026275Lus10012162Lus10026863Lus10018918Lus10028619
Lus10010029Lus10036331Lus10007584
Malus domesticaMDP0000225700MDP0000388002MDP0000452189MDP0000518321MDP0000313820.215.533
MDP0000313820.215.533MDP0000308015MDP0000896140MDP0000140066.486.637MDP0000140066.486.637
MDP0000221017MDP0000160026MDP0000313820.118.215MDP0000313820.118.215MDP0000144703
Manihot esculentacassava4.1_003705mcassava4.1_003712mcassava4.1_026565m
Medicago truncatulaMedtr2g028480.1Medtr3g082440.1Medtr3g090540.1Medtr4g128810.1
Mimulus guttatusmgv1a003033mmgv1a002977mmgv1a002970mmgv1a002960mmgv1a022358m
mgv1a018926mmgv1a018124mmgv1a024415mmgv1a026839m
Oryza sativaLOC_Os03g21210.1LOC_Os03g52630.1LOC_Os03g52630.2LOC_Os04g41970.1LOC_Os12g24040.1
Panicum virgatumPavirv00061241mPavirv00029143mPavirv00040687mPavirv00029144mPavirv00038435m
Pavirv00038432mPavirv00007671mPavirv00061242mPavirv00005986mPavirv00061243m
Pavirv00044338mPavirv00049329mPavirv00048097m
Physcomitrella patensPp1s190_6V6.1Pp1s157_35V6.1Pp1s35_333V6.1Pp1s15_429V6.1Pp1s64_152V6.1
Phaseolus vulgarisPhvul.003G089600.1Phvul.006G133700.1Phvul.006G004900.1Phvul.009G135900.1
Picea abiesMA_69345g0010MA_102312g0010.133.408MA_102312g0010.133.408MA_9211546g0010MA_102312g0010.413.556
MA_102312g0010.413.556MA_6683906g0010.193.294MA_6683906g0010.193.294
Populus trichocarpaPotri.003G151700.1Potri.003G151700.2Potri.001G078900.1Potri.003G151700.3Potri.010G177300.1
Potri.008G079500.1Potri.010G177300.3Potri.010G177300.2Potri.003G151700.4Potri.005G188500.1
Potri.002G071200.1
Prunus persicappa002911mppa014845mppa026228mppa019140m
Ricinus communis30063.m00143629929.m00450230076.m00469627985.m000864
Setaria italicaSi034713mSi009616mSi012680mSi035386m
Selaginella moellendorffii26652275214
Sorghum bicolorSb01g036480.1Sb01g008860.1Sb06g021440.1
Thellungiella halophilaThhalv10012978mThhalv10024681mThhalv10018270mThhalv10003366mThhalv10012932m.108.387
Thhalv10012932m.108.387Thhalv10012932m.412.610Thhalv10012932m.412.610
Vitis viniferaGSVIVT01023102001GSVIVT01006265001GSVIVT01010049001GSVIVT01006152001
Zea maysAC199765.4_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)