| Basic Information | |
|---|---|
| Species | Arabidopsis lyrata |
| Cazyme ID | 870710 |
| Family | CBM43 |
| Protein Properties | Length: 86 Molecular Weight: 8994 Isoelectric Point: 4.1409 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 1 | 83 | 1.3e-30 |
| CVAKNNAEDSALQTTIDWACGPGGADCGGIQQGGSCYDPLMIVKMASYVFNNYYLKNGLADEACNFSNNAAVTSLNPSQGTCK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 86 Download |
| CVAKNNAEDS ALQTTIDWAC GPGGADCGGI QQGGSCYDPL MIVKMASYVF NNYYLKNGLA 60 DEACNFSNNA AVTSLNPSQG TCKFPS 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 2.0e-6 | 1 | 70 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-18 | 1 | 84 | 84 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAM67357.1 | 1.99965e-42 | 1 | 86 | 83 | 168 | unknown [Arabidopsis thaliana] |
| EMBL | CAB68148.1 | 1.99965e-42 | 1 | 86 | 118 | 203 | putative protein [Arabidopsis thaliana] |
| RefSeq | NP_567060.1 | 7.00649e-43 | 1 | 86 | 42 | 127 | PDCB5 (PLASMODESMATA CALLOSE-BINDING PROTEIN 5); callose binding / polysaccharide binding [Arabidopsis thaliana] |
| RefSeq | XP_002326029.1 | 6e-36 | 1 | 86 | 37 | 122 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002525141.1 | 9e-37 | 1 | 86 | 34 | 119 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 1e-16 | 1 | 86 | 14 | 98 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EH423656 | 86 | 1 | 86 | 9e-32 |
| EH423657 | 86 | 1 | 86 | 2e-31 |
| FG554974 | 86 | 1 | 86 | 3e-31 |
| EX092087 | 86 | 1 | 86 | 5e-31 |
| DK470788 | 86 | 1 | 86 | 5e-31 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
