Basic Information | |
---|---|
Species | Arabidopsis lyrata |
Cazyme ID | 880784 |
Family | GH17 |
Protein Properties | Length: 117 Molecular Weight: 12665.7 Isoelectric Point: 10.819 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH17 | 1 | 113 | 9.5e-37 |
NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPNGDIPALTNGRQARRWVSANILPFHPQTKIKYISVGNEILLTGDNNMINNLLPA MRNLNNALVRAGI |
Full Sequence |
---|
Protein Sequence Length: 117 Download |
NLPPPTQVAN FIKTQTSIDS VKIFDVNPDI LRAFAGTGIS VVVTVPNGDI PALTNGRQAR 60 RWVSANILPF HPQTKIKYIS VGNEILLTGD NNMINNLLPA MRNLNNALVR AGIFLF* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00332 | Glyco_hydro_17 | 2.0e-27 | 1 | 113 | 114 | + Glycosyl hydrolases family 17. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAK76666.1 | 0 | 1 | 113 | 38 | 150 | putative beta-1,3-glucanase [Arabidopsis thaliana] |
GenBank | AAM66982.1 | 0 | 1 | 113 | 38 | 150 | beta-1,3-glucanase-like protein [Arabidopsis thaliana] |
RefSeq | NP_191103.1 | 0 | 1 | 113 | 38 | 150 | glycosyl hydrolase family 17 protein / beta-1,3-glucanase, putative [Arabidopsis thaliana] |
RefSeq | XP_002283660.1 | 2.00386e-43 | 1 | 113 | 38 | 150 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
RefSeq | XP_002530862.1 | 9.94922e-44 | 1 | 113 | 38 | 150 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3f55_D | 3e-18 | 1 | 113 | 12 | 125 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 3f55_C | 3e-18 | 1 | 113 | 12 | 125 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 3f55_B | 3e-18 | 1 | 113 | 12 | 125 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 3f55_A | 3e-18 | 1 | 113 | 12 | 125 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 3em5_D | 3e-18 | 1 | 113 | 12 | 125 | A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR323458 | 113 | 1 | 113 | 0 |
DR323435 | 113 | 1 | 113 | 0 |
DR323498 | 113 | 1 | 113 | 0 |
DR323439 | 113 | 1 | 113 | 0 |
DR323486 | 113 | 1 | 113 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|