Basic Information | |
---|---|
Species | Arabidopsis lyrata |
Cazyme ID | 883627 |
Family | GH16 |
Protein Properties | Length: 262 Molecular Weight: 29851.2 Isoelectric Point: 6.7899 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH16 | 15 | 182 | 2.4e-28 |
QDHVLKLNQSKEVQLSMDHSSGSGFESKNHYGSGFFQMRIKLPAKDSAGIVTAFYLTSKGNSQDEVDFEFLGNREGKPITIQTNVFTKGQGNREQRFVLW FDPTEDFHAYGILWNPYHIVFYVDNIPIRVFKNNKKGVSYPSKPMQVVSSLWNGEAWATDGGKAKINW |
Full Sequence |
---|
Protein Sequence Length: 262 Download |
MESSFDEHYV VTWGQDHVLK LNQSKEVQLS MDHSSGSGFE SKNHYGSGFF QMRIKLPAKD 60 SAGIVTAFYL TSKGNSQDEV DFEFLGNREG KPITIQTNVF TKGQGNREQR FVLWFDPTED 120 FHAYGILWNP YHIVFYVDNI PIRVFKNNKK GVSYPSKPMQ VVSSLWNGEA WATDGGKAKI 180 NWAYAPFKAH FQGFSESGCH MDGLNDACES SAYWWNTGKY VGISVSEQKA FKNARAKYMN 240 YDYCSDHTRF SVPPDECQWN Q* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00413 | Glyco_hydrolase_16 | 4.0e-22 | 32 | 176 | 154 | + glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
cd02175 | GH16_lichenase | 3.0e-24 | 6 | 169 | 173 | + lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure. | ||
pfam00722 | Glyco_hydro_16 | 1.0e-75 | 5 | 184 | 182 | + Glycosyl hydrolases family 16. | ||
PLN03161 | PLN03161 | 1.0e-84 | 1 | 257 | 264 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
cd02176 | GH16_XET | 6.0e-143 | 3 | 257 | 260 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005618 | cell wall |
GO:0005975 | carbohydrate metabolic process |
GO:0006073 | cellular glucan metabolic process |
GO:0016762 | xyloglucan:xyloglucosyl transferase activity |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK28571.1 | 0 | 4 | 257 | 34 | 289 | unknown [Arabidopsis thaliana] |
RefSeq | NP_189141.1 | 0 | 4 | 257 | 34 | 289 | XTH3 (XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 3); hydrolase, acting on glycosyl bonds / xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana] |
RefSeq | NP_193044.2 | 0 | 5 | 260 | 36 | 291 | xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative [Arabidopsis thaliana] |
RefSeq | NP_193045.1 | 0 | 5 | 261 | 32 | 292 | xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative [Arabidopsis thaliana] |
Swiss-Prot | Q9SV61 | 0 | 5 | 260 | 39 | 294 | XTH1_ARATH RecName: Full=Putative xyloglucan endotransglucosylase/hydrolase protein 1; Short=At-XTH1; Short=XTH-1; Flags: Precursor |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1un1_B | 0 | 1 | 258 | 13 | 273 | A Chain A, Apo Form Of A Mutant Of Glycogenin In Which Asp159 Is Replaced By Asn |
PDB | 1un1_A | 0 | 1 | 258 | 13 | 273 | A Chain A, Apo Form Of A Mutant Of Glycogenin In Which Asp159 Is Replaced By Asn |
PDB | 1umz_B | 0 | 1 | 258 | 13 | 273 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
PDB | 1umz_A | 0 | 1 | 258 | 13 | 273 | A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg. |
PDB | 2uwb_B | 0 | 5 | 257 | 20 | 267 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EE533496 | 254 | 13 | 262 | 0 |
CO116549 | 260 | 5 | 257 | 0 |
EV529686 | 258 | 4 | 257 | 0 |
ES827892 | 265 | 5 | 262 | 0 |
EE458623 | 203 | 52 | 250 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|