| Basic Information | |
|---|---|
| Species | Arabidopsis lyrata |
| Cazyme ID | 894381 |
| Family | CBM43 |
| Protein Properties | Length: 114 Molecular Weight: 12688.5 Isoelectric Point: 6.6536 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 26 | 110 | 1.6e-27 |
| WCVSAASAPDTQLQLQANIDWACSIGKVDYVKINLGGDCYEPNTPTSHASFVMNDYYQNHGNTEETCDFNHTGQIIGADPSYRRC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 114 Download |
| MFPQLKLIVL LSLVVIHLLH VLAKKWCVSA ASAPDTQLQL QANIDWACSI GKVDYVKINL 60 GGDCYEPNTP TSHASFVMND YYQNHGNTEE TCDFNHTGQI IGADPSYRRC RYT* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 5.0e-14 | 25 | 98 | 79 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-29 | 25 | 112 | 88 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK28052.1 | 6e-26 | 3 | 112 | 7 | 114 | unknown [Arabidopsis thaliana] |
| RefSeq | NP_001031243.1 | 0 | 1 | 113 | 1 | 111 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_001117561.1 | 7.9874e-44 | 1 | 113 | 1 | 110 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_176859.1 | 0 | 1 | 113 | 1 | 111 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| RefSeq | NP_974558.1 | 1e-39 | 1 | 113 | 1 | 111 | Expressed protein [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 2e-17 | 23 | 112 | 10 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
