Basic Information | |
---|---|
Species | Arabidopsis lyrata |
Cazyme ID | 894389 |
Family | CBM43 |
Protein Properties | Length: 84 Molecular Weight: 9282.13 Isoelectric Point: 4.6438 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 78 | 6.3e-30 |
TTDTQLQANIDWACNEGQVDCAKINPGGVCYEPNTPTSHASFVMNDYYRSHGSTEEACDFNHTGQIISGDPSYRRC |
Full Sequence |
---|
Protein Sequence Length: 84 Download |
MKTTDTQLQA NIDWACNEGQ VDCAKINPGG VCYEPNTPTS HASFVMNDYY RSHGSTEEAC 60 DFNHTGQIIS GDPSYRRCRY DVV* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-16 | 4 | 66 | 68 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-31 | 4 | 80 | 77 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_001031243.1 | 0 | 4 | 80 | 34 | 110 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001117561.1 | 4e-31 | 6 | 80 | 36 | 109 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001118954.1 | 5e-24 | 1 | 80 | 34 | 112 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_176859.1 | 2e-35 | 1 | 80 | 31 | 110 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_974558.1 | 3e-28 | 2 | 81 | 32 | 111 | Expressed protein [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 3e-19 | 4 | 80 | 21 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DY902345 | 80 | 1 | 80 | 3e-34 |
ES938078 | 81 | 1 | 81 | 7e-27 |
EE519283 | 79 | 3 | 81 | 8e-27 |
ES997284 | 79 | 3 | 81 | 1e-26 |
EE532647 | 81 | 1 | 81 | 1e-26 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|