| Basic Information | |
|---|---|
| Species | Arabidopsis lyrata |
| Cazyme ID | 894389 |
| Family | CBM43 |
| Protein Properties | Length: 84 Molecular Weight: 9282.13 Isoelectric Point: 4.6438 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 3 | 78 | 6.3e-30 |
| TTDTQLQANIDWACNEGQVDCAKINPGGVCYEPNTPTSHASFVMNDYYRSHGSTEEACDFNHTGQIISGDPSYRRC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 84 Download |
| MKTTDTQLQA NIDWACNEGQ VDCAKINPGG VCYEPNTPTS HASFVMNDYY RSHGSTEEAC 60 DFNHTGQIIS GDPSYRRCRY DVV* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 4.0e-16 | 4 | 66 | 68 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 3.0e-31 | 4 | 80 | 77 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_001031243.1 | 0 | 4 | 80 | 34 | 110 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_001117561.1 | 4e-31 | 6 | 80 | 36 | 109 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_001118954.1 | 5e-24 | 1 | 80 | 34 | 112 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_176859.1 | 2e-35 | 1 | 80 | 31 | 110 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| RefSeq | NP_974558.1 | 3e-28 | 2 | 81 | 32 | 111 | Expressed protein [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 3e-19 | 4 | 80 | 21 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| DY902345 | 80 | 1 | 80 | 3e-34 |
| ES938078 | 81 | 1 | 81 | 7e-27 |
| EE519283 | 79 | 3 | 81 | 8e-27 |
| ES997284 | 79 | 3 | 81 | 1e-26 |
| EE532647 | 81 | 1 | 81 | 1e-26 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
