y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis lyrata
Cazyme ID899104
FamilyGH16
Protein PropertiesLength: 291 Molecular Weight: 33248.1 Isoelectric Point: 6.8736
ChromosomeChromosome/Scaffold: 5 Start: 20238767 End: 20240056
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16492116.5e-28
  STLHSGEEVDLYIDQSSGGGFESKDSYGSGLFEMRIKVPGGNTGGIVTAFYLTSKGGGHDEIDFEFLGNNNGKPVTLQTNLFLNGEGNREERFLLWFNPT
  KHYHTYGLLWNPYQIVFYVDNIPIRVYKNENGVSYPSRPMQVEASLWNGDDWATDGGRTKVNW
Full Sequence
Protein Sequence     Length: 291     Download
MDYMRIFSVF VVTLWIIRVD ARVLGGRGIE KFVTFGQNYV VKWGQSHVST LHSGEEVDLY    60
IDQSSGGGFE SKDSYGSGLF EMRIKVPGGN TGGIVTAFYL TSKGGGHDEI DFEFLGNNNG    120
KPVTLQTNLF LNGEGNREER FLLWFNPTKH YHTYGLLWNP YQIVFYVDNI PIRVYKNENG    180
VSYPSRPMQV EASLWNGDDW ATDGGRTKVN WSYSPFIAHF RDFALSGCNI DGRSNNVGAC    240
ESSNYWWNAG KYQRLSGNEQ KLYEHVRSKY MNYDYCTDRS KYQTPPRECY *             300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02183GH16_fungal_CRH1_transglycosylase2.0e-2378222162+
cd00413Glyco_hydrolase_163.0e-2458207159+
pfam00722Glyco_hydro_166.0e-7435213181+
PLN03161PLN031614.0e-8435290261+
cd02176GH16_XET8.0e-14733289261+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0016762xyloglucan:xyloglucosyl transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK28571.1012901290unknown [Arabidopsis thaliana]
RefSeqNP_189141.1012901290XTH3 (XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 3); hydrolase, acting on glycosyl bonds / xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana]
RefSeqNP_193044.2012891288xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative [Arabidopsis thaliana]
RefSeqNP_193045.1012891288xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative [Arabidopsis thaliana]
Swiss-ProtQ9SV61012894291XTH1_ARATH RecName: Full=Putative xyloglucan endotransglucosylase/hydrolase protein 1; Short=At-XTH1; Short=XTH-1; Flags: Precursor
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1un1_B03328915272B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1un1_A03328915272B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1umz_B03328915272A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB1umz_A03328915272A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB2vh9_B062895290A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV529686282112910
DR25738622212220
DK49798225512520
CK121402200922910
EV571108242512910
Orthologous Group
SpeciesID
Arabidopsis lyrata884593485216359038359039883627
883616
Arabidopsis thalianaAT4G13090.1AT3G25050.1AT3G48580.1AT4G13080.1
Brachypodium distachyonBradi1g44777.1Bradi1g71937.1
Brassica rapaBra001434Bra015093Bra001433
Carica papayaevm.model.supercontig_8.136
Capsella rubellaCarubv10016385mCarubv10005358mCarubv10006916mCarubv10006944mCarubv10018461m
Citrus clementinaCiclev10033360mCiclev10023425m
Citrus sinensisorange1.1g042925morange1.1g041460m
Cucumis sativusCucsa.067150.1
Eucalyptus grandisEucgr.H00787.1Eucgr.H00788.1Eucgr.K02717.1Eucgr.K02715.1
Fragaria vescamrna17598.1-v1.0-hybrid
Glycine maxGlyma18g35720.2Glyma18g35720.1Glyma08g46450.1
Gossypium raimondiiGorai.007G155700.1Gorai.004G226400.1
Linum usitatissimumLus10032879Lus10025919Lus10038182Lus10022784Lus10011845
Lus10022782
Malus domesticaMDP0000311020
Manihot esculentacassava4.1_032567m
Medicago truncatulaMedtr2g049030.1Medtr2g049130.1
Mimulus guttatusmgv1a010995mmgv1a011712mmgv1a020473mmgv1a011649mmgv1a025665m
mgv1a019895mmgv1a020281mmgv1a021895mmgv1a011700mmgv1a010970m
Oryza sativaLOC_Os06g13040.1
Panicum virgatumPavirv00069636mPavirv00044296mPavirv00046059m
Phaseolus vulgarisPhvul.008G129900.1Phvul.008G129100.1
Picea abiesMA_300041g0010MA_10083496g0010MA_254951g0010
Populus trichocarpaPotri.002G244200.1
Prunus persicappa019741mppa027154m
Ricinus communis30204.m00174129904.m002924
Setaria italicaSi007117mSi006999m
Selaginella moellendorffii403283
Sorghum bicolorSb10g008540.1Sb10g008550.1
Thellungiella halophilaThhalv10002629mThhalv10010620mThhalv10026812m
Vitis viniferaGSVIVT01003280001GSVIVT01004746001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny