Basic Information | |
---|---|
Species | Arabidopsis lyrata |
Cazyme ID | 899301 |
Family | CBM43 |
Protein Properties | Length: 129 Molecular Weight: 14412.3 Isoelectric Point: 4.991 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 19 | 98 | 4.7e-31 |
WCVADPQIPDNVIQAALDWACQIGGADCSKIQPDQPCFLPNTVKDHASVVFNDYYQRYKHKGGTCDFHSAAVITQRDPSK |
Full Sequence |
---|
Protein Sequence Length: 129 Download |
MTIFKLSNLS TSKAEFGQWC VADPQIPDNV IQAALDWACQ IGGADCSKIQ PDQPCFLPNT 60 VKDHASVVFN DYYQRYKHKG GTCDFHSAAV ITQRDPSKQI YINPFVNSYL SSLINQDLEP 120 FVTDYLMI* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-18 | 18 | 90 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 1.0e-32 | 18 | 97 | 80 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92842.1 | 2e-37 | 4 | 99 | 16 | 111 | unknown [Populus trichocarpa] |
EMBL | CBI28425.1 | 5e-37 | 6 | 97 | 16 | 107 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001154494.1 | 0 | 12 | 97 | 8 | 93 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_178568.1 | 0 | 12 | 128 | 8 | 124 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002307902.1 | 2e-37 | 9 | 99 | 20 | 110 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-16 | 17 | 97 | 11 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DK539002 | 87 | 12 | 97 | 2e-37 |
DK479406 | 87 | 12 | 97 | 2e-37 |
DK457624 | 87 | 12 | 97 | 3e-37 |
EW730049 | 87 | 12 | 97 | 3e-37 |
DK517252 | 87 | 12 | 97 | 3e-37 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|