Basic Information | |
---|---|
Species | Arabidopsis lyrata |
Cazyme ID | 899941 |
Family | GH17 |
Protein Properties | Length: 112 Molecular Weight: 12036.1 Isoelectric Point: 5.784 |
Chromosome | Chromosome/Scaffold: 4 Start: 3863777 End: 3864010 |
Description | |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH17 | 22 | 101 | 7.9e-25 |
LGVYWGTMATHKLPPKTVVQMLKDNSINKVKLFDADETTMSALAGSGLEVMVAIPNDQLKVMGSYDRAKDWALKNVTRYN |
Full Sequence |
---|
Protein Sequence Length: 112 Download |
MMNLLAIVVG FGIMGIVVVD GLGVYWGTMA THKLPPKTVV QMLKDNSINK VKLFDADETT 60 MSALAGSGLE VMVAIPNDQL KVMGSYDRAK DWALKNVTRY NFNGGDVLSL D* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00332 | Glyco_hydro_17 | 4.0e-11 | 22 | 100 | 80 | + Glycosyl hydrolases family 17. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAD38251.1 | 9.99995e-41 | 29 | 105 | 1 | 77 | AC006193_7 Similar to glucan endo-1,3-beta-glucosidase precursor [Arabidopsis thaliana] |
GenBank | AAS99718.1 | 1.00053e-42 | 23 | 105 | 26 | 108 | At1g64760 [Arabidopsis thaliana] |
RefSeq | NP_176656.1 | 1.96182e-44 | 23 | 105 | 26 | 108 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
RefSeq | NP_179534.1 | 0 | 2 | 105 | 1 | 104 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
RefSeq | XP_002277003.1 | 8.00141e-43 | 12 | 105 | 15 | 108 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2cyg_A | 0.000000005 | 22 | 100 | 1 | 80 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 3f55_D | 0.00000001 | 22 | 97 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 3f55_C | 0.00000001 | 22 | 97 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 3f55_B | 0.00000001 | 22 | 97 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
PDB | 3f55_A | 0.00000001 | 22 | 97 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
Transmembrane Domains | ||||
---|---|---|---|---|
Start | End | |||
5 | 27 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EV064938 | 86 | 20 | 105 | 0 |
DY017027 | 86 | 20 | 105 | 0 |
DK507939 | 86 | 20 | 105 | 0 |
DK504977 | 86 | 20 | 105 | 0 |
DK507429 | 86 | 20 | 105 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|