| Basic Information | |
|---|---|
| Species | Arabidopsis lyrata |
| Cazyme ID | 899941 |
| Family | GH17 |
| Protein Properties | Length: 112 Molecular Weight: 12036.1 Isoelectric Point: 5.784 |
| Chromosome | Chromosome/Scaffold: 4 Start: 3863777 End: 3864010 |
| Description | |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 22 | 101 | 7.9e-25 |
| LGVYWGTMATHKLPPKTVVQMLKDNSINKVKLFDADETTMSALAGSGLEVMVAIPNDQLKVMGSYDRAKDWALKNVTRYN | |||
| Full Sequence |
|---|
| Protein Sequence Length: 112 Download |
| MMNLLAIVVG FGIMGIVVVD GLGVYWGTMA THKLPPKTVV QMLKDNSINK VKLFDADETT 60 MSALAGSGLE VMVAIPNDQL KVMGSYDRAK DWALKNVTRY NFNGGDVLSL D* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 4.0e-11 | 22 | 100 | 80 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAD38251.1 | 9.99995e-41 | 29 | 105 | 1 | 77 | AC006193_7 Similar to glucan endo-1,3-beta-glucosidase precursor [Arabidopsis thaliana] |
| GenBank | AAS99718.1 | 1.00053e-42 | 23 | 105 | 26 | 108 | At1g64760 [Arabidopsis thaliana] |
| RefSeq | NP_176656.1 | 1.96182e-44 | 23 | 105 | 26 | 108 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
| RefSeq | NP_179534.1 | 0 | 2 | 105 | 1 | 104 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
| RefSeq | XP_002277003.1 | 8.00141e-43 | 12 | 105 | 15 | 108 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.000000005 | 22 | 100 | 1 | 80 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 0.00000001 | 22 | 97 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 0.00000001 | 22 | 97 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 0.00000001 | 22 | 97 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 0.00000001 | 22 | 97 | 2 | 77 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Transmembrane Domains | ||||
|---|---|---|---|---|
 | ||||
| Start | End | |||
| 5 | 27 | |||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EV064938 | 86 | 20 | 105 | 0 |
| DY017027 | 86 | 20 | 105 | 0 |
| DK507939 | 86 | 20 | 105 | 0 |
| DK504977 | 86 | 20 | 105 | 0 |
| DK507429 | 86 | 20 | 105 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |