Basic Information | |
---|---|
Species | Arabidopsis lyrata |
Cazyme ID | 903754 |
Family | GH19 |
Protein Properties | Length: 226 Molecular Weight: 24652.9 Isoelectric Point: 7.9124 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 98 | 224 | 1.4013e-45 |
IASMFAHFTHETERFCNIEEVNGTSSDYCDKNNSLYPCAPGKSYFGRGPIQLSWNYNYGTCGQSLGLDLLRQPELVGSNSTVAFQTGLWFWMNSVRPVLD QGFGATIRAINAMECNGGNLGAVNARV |
Full Sequence |
---|
Protein Sequence Length: 226 Download |
MALTKIASVF LIYLFSFYSQ TAKSQFCGCS PILCCSQSGY CGITDQHCGS GCKSGPCRQS 60 RDPVDKIVTQ QFFNGIIDTR NGCAGKGFYT RDSFLQAIAS MFAHFTHETE RFCNIEEVNG 120 TSSDYCDKNN SLYPCAPGKS YFGRGPIQLS WNYNYGTCGQ SLGLDLLRQP ELVGSNSTVA 180 FQTGLWFWMN SVRPVLDQGF GATIRAINAM ECNGGNLGAV NARVR* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
smart00270 | ChtBD1 | 9.0e-6 | 29 | 55 | 27 | + Chitin binding domain. | ||
cd00035 | ChtBD1 | 7.0e-6 | 29 | 55 | 27 | + Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements. | ||
cd00442 | lysozyme_like | 7.0e-11 | 128 | 194 | 67 | + lysozyme_like domain. This contains several members including Soluble Lytic Transglycosylases (SLT), Goose Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, and chitosanases. All the members are involved in the hydrolysis of beta-1,4- linked polysaccharides. | ||
pfam00182 | Glyco_hydro_19 | 1.0e-64 | 67 | 225 | 213 | + Chitinase class I. | ||
cd00325 | chitinase_glyco_hydro_19 | 3.0e-67 | 68 | 225 | 211 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004568 | chitinase activity |
GO:0006032 | chitin catabolic process |
GO:0008061 | chitin binding |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABV89613.1 | 0 | 1 | 218 | 1 | 242 | chitinase [Brassica rapa] |
DDBJ | BAF35569.1 | 0 | 1 | 225 | 1 | 249 | chitinase [Brassica rapa subsp. pekinensis] |
RefSeq | NP_181886.1 | 0 | 1 | 224 | 1 | 245 | chitinase, putative [Arabidopsis thaliana] |
RefSeq | NP_181887.1 | 0 | 1 | 224 | 1 | 244 | chitinase, putative [Arabidopsis thaliana] |
Swiss-Prot | Q06209 | 0 | 1 | 225 | 1 | 249 | CHI4_BRANA RecName: Full=Basic endochitinase CHB4; Flags: Precursor |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3hbh_A | 0 | 64 | 225 | 2 | 185 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 3hbe_X | 0 | 64 | 225 | 2 | 185 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 3hbd_A | 0 | 64 | 225 | 2 | 185 | A Chain A, Class Iv Chitinase Structure From Picea Abies At 1.8a |
PDB | 3cql_B | 2e-32 | 64 | 194 | 2 | 164 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 3cql_A | 2e-32 | 64 | 194 | 2 | 164 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |