y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSelaginella moellendorffii
Cazyme ID90700
FamilyAA1
Protein PropertiesLength: 589 Molecular Weight: 65944.2 Isoelectric Point: 9.4461
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1913689.4e-23
  TIPGPTIEARNGIPVEITWENHLPKKHILPLDLTIATAIPRHGGIPTVVHLHGGMNDPASDGHSLAWFTPGFKDRGPAWRAKSSFYRNAQGAANLWYHDH
  AMGLTRANILAGLSGAYVIRDPALERRMNLPSGKDFDRVLIIADRDFNKDGSIYMNSKGNNPKIHPQWQPEYFGSVILVNGKAWPFLRVAKRKYRFRIIN
  SSNARFYELRLSDHSAGSSSDDDSGSLLTFTQIGSDAFYLPRPIRARRLTIAPSEIQDVIIDFTQARRDKVLLRNTAA
Full Sequence
Protein Sequence     Length: 589     Download
MDLILLLLAL LLGIFGSHRA SSQSLNATGL EKFVDELPQI PVLCAFQEEQ SGAMIKPANL    60
TIGMFPTRWK FHRDLPATPV FAYGRSHKEA TIPGPTIEAR NGIPVEITWE NHLPKKHILP    120
LDLTIATAIP RHGGIPTVVH LHGGMNDPAS DGHSLAWFTP GFKDRGPAWR AKSSFYRNAQ    180
GAANLWYHDH AMGLTRANIL AGLSGAYVIR DPALERRMNL PSGKDFDRVL IIADRDFNKD    240
GSIYMNSKGN NPKIHPQWQP EYFGSVILVN GKAWPFLRVA KRKYRFRIIN SSNARFYELR    300
LSDHSAGSSS DDDSGSLLTF TQIGSDAFYL PRPIRARRLT IAPSEIQDVI IDFTQARRDK    360
VLLRNTAAFP FPGGDAVDSN NGVVMKFLVA ARSSQQLDPS TIPRFLVPIQ RLAIEQSSSA    420
RQINLYEFVS SSDEPTHLWI NALPFDAPAT ETPRCGSTEL WSVINLTEDN HPLHLHLAAF    480
QVIDEARLSS AEDLRRCLLA NGNRMNASCN AERFIDRSSP RRRPPRNEAG WKNVYKMKPG    540
YLTRFLVRFA GIDGRPYPFD ASAEPGYAYH CHILDHEDNE MMRPLKLR*                600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10965PRK109657.0e-8440582147+
pfam07732Cu-oxidase_33.0e-1091213130+
PRK10883PRK108834.0e-1593355272+
PRK10965PRK109656.0e-1893354279+
COG2132SufI7.0e-3664585528+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAB72167.1045871566unknown [Arabidopsis thaliana]
GenBankABG81319.10358713579low-phosphate root 1 [Arabidopsis thaliana]
GenBankABR18419.1055888582unknown [Picea sitchensis]
DDBJBAC42623.10358713579unknown protein [Arabidopsis thaliana]
RefSeqNP_173714.20358713579LPR1 (Low Phosphate Root1); copper ion binding / oxidoreductase, acting on diphenols and related substances as donors, oxygen as acceptor [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zdw_A0305873508A Chain A, Solution Structure Of The C-Terminal Gal-Bind Lectin Domain From Human Galectin-4
PDB2x88_A0305873508A Chain A, Solution Structure Of The C-Terminal Gal-Bind Lectin Domain From Human Galectin-4
PDB2x87_A0305873508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2bhf_A0305873508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB1w8e_A0305873508A Chain A, Crystal Structure Of The Reconstituted Cota
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778093534565870
HO7965214731175870
DR690750293703620
ES833412319173340
EL443532308693750
Orthologous Group
SpeciesID
Arabidopsis lyrata472551
Brassica rapaBra024558Bra016163
Carica papayaevm.model.supercontig_65.123
Capsella rubellaCarubv10020039m
Eucalyptus grandisEucgr.B00864.1Eucgr.B00863.1Eucgr.B00862.1
Glycine maxGlyma20g26270.3Glyma20g26270.2Glyma20g26270.1Glyma10g41010.1
Gossypium raimondiiGorai.005G162700.1
Manihot esculentacassava4.1_004784m
Mimulus guttatusmgv1a004781m
Oryza sativaLOC_Os01g03640.1LOC_Os01g03630.1LOC_Os01g03620.1LOC_Os01g03530.2LOC_Os01g03530.1
Panicum virgatumPavirv00060261mPavirv00051027mPavirv00039074m
Physcomitrella patensPp1s40_48V6.1Pp1s40_48V6.2Pp1s40_48V6.3Pp1s40_48V6.4Pp1s40_48V6.5
Pp1s40_48V6.6
Phaseolus vulgarisPhvul.007G038200.1
Picea abiesMA_64691g0010MA_10432589g0010
Setaria italicaSi005198mSi004323m
Sorghum bicolorSb03g007440.1
Thellungiella halophilaThhalv10007182m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny