y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis lyrata
Cazyme ID909245
FamilyGH127
Protein PropertiesLength: 863 Molecular Weight: 96392.1 Isoelectric Point: 7.276
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1273586331.3e-25
  LHKEISIFFMDIVNASHSYATGGTSVSEFWQNPKRMATTLQTENEESCTTYNMLKVSRNLFRWTKEVSYADYYERALTNGVLGIQRGTQPGLMIYMLPLG
  KGVSKAVTYHGWGTPYDSFWCCYGTGIESFSKLGDSIYFQEDDVSPALYVTQYISSSLDWKSAGLSLSQKVNPVVSWDPYMRVTFSFSSSKGGMAKESTL
  NLRIPVWTNSVGAKISLNGQSLKVPNFRTRNFLSIKQNWKSGDQLTMELPLSIRTEAIKDDRQEYSSLQAILYGPY
Full Sequence
Protein Sequence     Length: 863     Download
MKSGLIITIV LLLYTSFVLV CVAKECTNTP TQLSSHTFRS ELLQSKNETL KTELFSHYHL    60
TPTDDAAWST LLPRKMLKEE ADEFAWTMLY RTFKDSNSSG NFLKEVSLHD VRLDPNSFHG    120
RAQQTNLEYL LMLDVDGLAW SFRKEAGLDA PGDHYGGWEK PDSELRGHFV GHYLSATAYM    180
WASTHNDTLK EKMSALVSAL SECQQKSGTG YLSAFPSSFF DRFEAITPVW APYYTIHKII    240
AGLVDQYKLA GNSQALQMAT GMADYFYGRV RNVIRKYSVE RHWQSLNEET GGMNDILYQL    300
YSITGDSKYL LLAHLFDKPC FLGVLAIQAD DISGFHSNTH IPIVVGSQQR YEITGDPLHK    360
EISIFFMDIV NASHSYATGG TSVSEFWQNP KRMATTLQTE NEESCTTYNM LKVSRNLFRW    420
TKEVSYADYY ERALTNGVLG IQRGTQPGLM IYMLPLGKGV SKAVTYHGWG TPYDSFWCCY    480
GTGIESFSKL GDSIYFQEDD VSPALYVTQY ISSSLDWKSA GLSLSQKVNP VVSWDPYMRV    540
TFSFSSSKGG MAKESTLNLR IPVWTNSVGA KISLNGQSLK VPNFRTRNFL SIKQNWKSGD    600
QLTMELPLSI RTEAIKDDRQ EYSSLQAILY GPYLLAGHTS RDWSITTQAK AGKWITPIPE    660
TQNSYLVTLS QQSGDISYVF SNSNQTITMR VSPEPGTQDA VAATFRLVTD NSKPRISGPE    720
ALIGSLVKLE PFDFPGMIVK QATDSSLTVQ ASSPSDKGAS SFRLVSGVDG KPGSVSLRLE    780
SKKGCFVYSD QTLKQGTKLR LECGSAATDE KFKEAASFKL KTGMNQYNPM SFVMSGTQRN    840
FVLSPLFSLR DETYNVYFSV QT*                                            900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3533COG35331.0e-75108642540+
pfam07944DUF16800110636536+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB88260.102486124859putative protein [Arabidopsis thaliana]
RefSeqNP_196799.102486225861catalytic [Arabidopsis thaliana]
RefSeqNP_196800.202486129864catalytic [Arabidopsis thaliana]
RefSeqXP_002285548.1058614863PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002297785.1048613857predicted protein [Populus trichocarpa]
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR4453932682795460
ES8033983001003990
DR4598412911134010
FD9484132393085460
GO8434393523036540
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00256.1Aquca_009_00257.1
Arabidopsis lyrata350453488069
Arabidopsis thalianaAT5G12960.1AT5G12950.1
Brachypodium distachyonBradi1g36027.1
Brassica rapaBra006171Bra023384
Carica papayaevm.model.supercontig_84.84evm.model.supercontig_84.86
Capsella rubellaCarubv10000417mCarubv10000198m
Citrus clementinaCiclev10014240mCiclev10018011mCiclev10004509mCiclev10014230m
Citrus sinensisorange1.1g002872morange1.1g005721morange1.1g007445morange1.1g002940morange1.1g007459m
orange1.1g010393morange1.1g007406morange1.1g002978morange1.1g002973morange1.1g043003m
orange1.1g006861m
Cucumis sativusCucsa.065400.2Cucsa.065400.1
Eucalyptus grandisEucgr.B03672.1Eucgr.B03675.1Eucgr.B03677.1
Fragaria vescamrna20619.1-v1.0-hybrid
Glycine maxGlyma12g05980.1Glyma11g14020.2Glyma11g14020.1
Malus domesticaMDP0000306372MDP0000208326MDP0000125504
Manihot esculentacassava4.1_001514m
Medicago truncatulaMedtr4g065150.1
Mimulus guttatusmgv1a002509mmgv1a001146m
Oryza sativaLOC_Os02g10190.1LOC_Os06g41020.1
Panicum virgatumPavirv00026390m
Physcomitrella patensPp1s60_268V6.1
Phaseolus vulgarisPhvul.011G057700.2Phvul.011G057700.1Phvul.011G057700.3Phvul.011G057800.1Phvul.005G149100.1
Phvul.005G149100.2
Populus trichocarpaPotri.003G206000.2Potri.T087500.1Potri.003G206000.4Potri.003G206000.3Potri.003G206000.1
Potri.001G018200.1
Prunus persicappa001713m
Setaria italicaSi005995mSi016279mSi005830mSi016278m
Selaginella moellendorffii3065089765
Sorghum bicolorSb10g024070.1Sb04g006520.1
Thellungiella halophilaThhalv10012662m
Vitis viniferaGSVIVT01025310001GSVIVT01025321001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny