| Basic Information | |
|---|---|
| Species | Arabidopsis lyrata |
| Cazyme ID | 910092 |
| Family | GH17 |
| Protein Properties | Length: 100 Molecular Weight: 10764.2 Isoelectric Point: 4.3309 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 6 | 93 | 8.7e-27 |
| TTNVPSPSNDISFYKSIGVTKIRILDPNTEVLNALRGIPNISVTVGVKKQDLDALASYDAAKNWIATNIEPYLADVNITSIIVGNEVI | |||
| Full Sequence |
|---|
| Protein Sequence Length: 100 Download |
| MASSETTNVP SPSNDISFYK SIGVTKIRIL DPNTEVLNAL RGIPNISVTV GVKKQDLDAL 60 ASYDAAKNWI ATNIEPYLAD VNITSIIVGN EVIVEIFRE* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-19 | 8 | 94 | 88 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAM62473.1 | 4e-24 | 8 | 93 | 44 | 130 | beta-1,3-glucanase bg4 [Arabidopsis thaliana] |
| RefSeq | NP_174592.1 | 4e-31 | 8 | 93 | 44 | 130 | beta-1,3-glucanase, putative [Arabidopsis thaliana] |
| RefSeq | NP_197533.1 | 3e-26 | 8 | 93 | 44 | 130 | BETAG4; catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | NP_197534.1 | 7e-30 | 8 | 93 | 53 | 139 | BG5 (beta-1,3-glucanase 5); glucan 1,3-beta-glucosidase/ hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana] |
| RefSeq | NP_197556.1 | 3e-27 | 8 | 93 | 44 | 130 | beta-1,3-glucanase, putative [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3f55_D | 0.00000000000009 | 5 | 92 | 9 | 95 | A Chain A, Crystal Structure Of Bifunctional Methyltransferase Ycby (Rlmlk) From Escherichia Coli, Sah Binding |
| PDB | 3f55_C | 0.00000000000009 | 5 | 92 | 9 | 95 | A Chain A, Crystal Structure Of Bifunctional Methyltransferase Ycby (Rlmlk) From Escherichia Coli, Sah Binding |
| PDB | 3f55_B | 0.00000000000009 | 5 | 92 | 9 | 95 | A Chain A, Crystal Structure Of Bifunctional Methyltransferase Ycby (Rlmlk) From Escherichia Coli, Sah Binding |
| PDB | 3f55_A | 0.00000000000009 | 5 | 92 | 9 | 95 | A Chain A, Crystal Structure Of Bifunctional Methyltransferase Ycby (Rlmlk) From Escherichia Coli, Sah Binding |
| PDB | 3em5_D | 0.00000000000009 | 5 | 92 | 9 | 95 | A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| EE454654 | 87 | 8 | 93 | 6e-31 |
| DR369083 | 87 | 8 | 93 | 7e-26 |
| EE564686 | 87 | 8 | 93 | 7e-25 |
| AV824400 | 87 | 8 | 93 | 1e-24 |
| HS559495 | 91 | 8 | 97 | 6e-20 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |