| Basic Information | |
|---|---|
| Species | Arabidopsis lyrata |
| Cazyme ID | 915838 |
| Family | CBM43 |
| Protein Properties | Length: 100 Molecular Weight: 10818.3 Isoelectric Point: 8.1952 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 13 | 94 | 4e-24 |
| WCVVKPGTPIQQLLKNINYVCSKINCDILSNASACYSSLNLYNLASVSMNLYYQSQGRQFSTCDFGGSGLISVTDPSCGCCK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 100 Download |
| MRVNAQAPSQ GSWCVVKPGT PIQQLLKNIN YVCSKINCDI LSNASACYSS LNLYNLASVS 60 MNLYYQSQGR QFSTCDFGGS GLISVTDPSC GCCKYEFHK* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 6.0e-13 | 12 | 81 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 7.0e-23 | 12 | 95 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAB64040.1 | 9e-39 | 1 | 89 | 23 | 113 | putative beta-1,3-glucanase, C terminal fragment [Arabidopsis thaliana] |
| GenBank | AAT41831.1 | 1e-29 | 1 | 99 | 22 | 120 | At2g43670 [Arabidopsis thaliana] |
| RefSeq | NP_181895.2 | 1e-29 | 1 | 99 | 23 | 121 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| RefSeq | NP_850398.1 | 2.00386e-43 | 1 | 99 | 22 | 122 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| RefSeq | NP_973680.1 | 2.00386e-43 | 1 | 99 | 23 | 123 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 1e-16 | 9 | 96 | 9 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| BP596959 | 102 | 1 | 100 | 2.99878e-43 |
| AU227421 | 102 | 1 | 100 | 3.9937e-43 |
| AU236487 | 81 | 1 | 79 | 2e-31 |
| GE522216 | 98 | 3 | 100 | 3e-29 |
| EE657217 | 96 | 5 | 100 | 3e-29 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
