y PlantCAZyme

CAZyme Information

Basic Information
SpeciesArabidopsis lyrata
Cazyme ID918074
FamilyGT68
Protein PropertiesLength: 567 Molecular Weight: 64608.7 Isoelectric Point: 7.0863
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT682465440
  DRVLVIPSSKFDYQYDRVIDIEGINTCLGRNVVVSFDQFKEKAKKNHFRIDRFICYFSSPQLCYVDEEHIKKLKGLGISIDGKLEAPWSEDIKKPSKRTV
  QDVQTKFKSDDDVIAIGDVFYADMEQDWVMQPGGPINHKCKTLIEPSKLILLTAQRFIQTFLGKNFIALHFRRHGFLKFCNAKSPSCFYPIPQAAECIAR
  IVERSNGAVIYLSTDAAESETSLLQSLVVVDGKIVPLVKRPPRNSAEKWDALLYRHGIEDDSQVDAMLDKTICAMSSVFIGASGSTFTEDILRLRKDWG
Full Sequence
Protein Sequence     Length: 567     Download
MERNSSDDEE DHQHLIPQND TRIRHREDPI SSTATTTGGN QRSAFQIEDI LQRVQRRWKI    60
SLNKRYVIVF VSLIISIGLL FLLTDPRELF SANFSSFKLD PLSNRVKESE LRALYLLRQQ    120
QLALLSLWNG TLVNPSLNQS ENDLRSSVLF EDVKSAVSKQ ISLNKEIQNV LLSPHRSSNY    180
SGGTEVDSVN FSYDRCRKVD QKLSDRKTVE WKPRSDKFLF AICLSGQMSN HLICLEKHMF    240
FAALLDRVLV IPSSKFDYQY DRVIDIEGIN TCLGRNVVVS FDQFKEKAKK NHFRIDRFIC    300
YFSSPQLCYV DEEHIKKLKG LGISIDGKLE APWSEDIKKP SKRTVQDVQT KFKSDDDVIA    360
IGDVFYADME QDWVMQPGGP INHKCKTLIE PSKLILLTAQ RFIQTFLGKN FIALHFRRHG    420
FLKFCNAKSP SCFYPIPQAA ECIARIVERS NGAVIYLSTD AAESETSLLQ SLVVVDGKIV    480
PLVKRPPRNS AEKWDALLYR HGIEDDSQVD AMLDKTICAM SSVFIGASGS TFTEDILRLR    540
KDWGTSSTCD EYLCRGEEPN FIAEDE*                                        600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11296O-FucT_like0.000521825235+
pfam10250O-FucT9.0e-5241533331+
cd11548NodZ_like2.0e-5347541198+
cd11298O-FucT-23.0e-9407533127+
cd11296O-FucT_like6.0e-18382540169+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD50008.1015661594AC007651_3 Hypothetical Protein [Arabidopsis thaliana]
GenBankAAM66093.1015661566unknown [Arabidopsis thaliana]
RefSeqNP_173170.2015661564unknown protein [Arabidopsis thaliana]
RefSeqNP_199853.1015661566unknown protein [Arabidopsis thaliana]
RefSeqXP_002264087.1015661559PREDICTED: hypothetical protein [Vitis vinifera]
Transmembrane Domains
StartEnd
6684
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX1285552972085040
EG4477322851324160
EG4477262851324160
EG4477332591323900
EG447732274074330.00003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00900.1Aquca_013_00900.2
Arabidopsis lyrata889130474511
Arabidopsis thalianaAT5G50420.1AT1G17270.1AT1G53770.2AT1G53770.1
Brachypodium distachyonBradi1g23980.1
Brassica rapaBra039691Bra016609Bra022515
Carica papayaevm.model.supercontig_25.202
Capsella rubellaCarubv10008736mCarubv10026161mCarubv10008696m
Citrus clementinaCiclev10025289m
Citrus sinensisorange1.1g008526m
Cucumis sativusCucsa.088930.1Cucsa.149140.2Cucsa.088930.2Cucsa.149140.1
Eucalyptus grandisEucgr.J02587.1Eucgr.I02168.1
Fragaria vescamrna05486.1-v1.0-hybrid
Glycine maxGlyma16g01730.1Glyma07g05200.1
Gossypium raimondiiGorai.010G172800.1Gorai.006G090800.1Gorai.011G054400.1
Linum usitatissimumLus10037461Lus10003929
Malus domesticaMDP0000692823MDP0000881647MDP0000203531
Manihot esculentacassava4.1_004684m
Medicago truncatulaMedtr8g023490.1
Mimulus guttatusmgv1a003863m
Oryza sativaLOC_Os07g38490.1
Panicum virgatumPavirv00005372mPavirv00007596m
Physcomitrella patensPp1s149_19V6.1
Phaseolus vulgarisPhvul.010G122400.1Phvul.009G261000.1
Picea abiesMA_10437033g0010
Populus trichocarpaPotri.003G073500.5Potri.003G073500.1Potri.003G073500.2Potri.003G073500.3Potri.003G073500.4
Potri.003G073500.6
Prunus persicappa004150m
Ricinus communis29884.m000188
Setaria italicaSi029376m
Selaginella moellendorffii146424410382
Sorghum bicolorSb02g037060.1
Thellungiella halophilaThhalv10013133mThhalv10007186mThhalv10011359m
Vitis viniferaGSVIVT01016658001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny