Basic Information | |
---|---|
Species | Arabidopsis lyrata |
Cazyme ID | 918445 |
Family | CBM43 |
Protein Properties | Length: 111 Molecular Weight: 12131.9 Isoelectric Point: 5.3734 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 28 | 108 | 2.2e-30 |
WCSAMPSSTAEQLQFNINFACRHVDCAPIQPGGFCYYPNTLLDHASFVMNSYYQSQGRTYAACSFGNTGYLIYSDPSSGTC |
Full Sequence |
---|
Protein Sequence Length: 111 Download |
MSSQLLTLLF LLCAAVIYHI PVVTCEPWCS AMPSSTAEQL QFNINFACRH VDCAPIQPGG 60 FCYYPNTLLD HASFVMNSYY QSQGRTYAAC SFGNTGYLIY SDPSSGTCVF * 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 7.0e-18 | 28 | 97 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 8.0e-34 | 28 | 110 | 84 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_001078361.1 | 8e-34 | 1 | 110 | 4 | 114 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001078788.1 | 9e-37 | 20 | 110 | 17 | 108 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_192648.2 | 2e-34 | 3 | 110 | 5 | 114 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_200172.1 | 0 | 14 | 110 | 14 | 111 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_200173.1 | 0 | 1 | 110 | 1 | 110 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 8e-22 | 28 | 110 | 13 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |