y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSelaginella moellendorffii
Cazyme ID92002
FamilyPL1
Protein PropertiesLength: 321 Molecular Weight: 34859.7 Isoelectric Point: 8.9532
View CDS
External Links
NCBI Taxonomy
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1562310
  FAKSMIITLTEMLWIRSSTTIDGRGVNITINGRSIVLAGVKNVILHNFQINTVGETDTVHIFAGTSNVWVDHLTSFNAKLGLVSVVQGSTDVTISNCFLT
  NPNFNMLLGASDADIQDQKMRVTVYRNWFKDSMQRMPHCRWGYCHVINNLYTNWGYYAIGARARAKVKSEANVFIA
Full Sequence
Protein Sequence     Length: 321     Download
LPTCVVGFAS GTTGGAQGQS YIVTNADDNA VTPSKGTLRY GVSLGGDDKG GVWITFAKSM    60
IITLTEMLWI RSSTTIDGRG VNITINGRSI VLAGVKNVIL HNFQINTVGE TDTVHIFAGT    120
SNVWVDHLTS FNAKLGLVSV VQGSTDVTIS NCFLTNPNFN MLLGASDADI QDQKMRVTVY    180
RNWFKDSMQR MPHCRWGYCH VINNLYTNWG YYAIGARARA KVKSEANVFI AARRPEVTPW    240
FQGVGADFDL TPVIQSTGDL LLNGSTFHQF LQFGPAIAPQ YRSEAYYPPK RATSTLATLV    300
QNCAGALFGT RVTKCIYVSS *                                              360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB2.0e-316235255+
pfam00544Pec_lyase_C7.0e-4072229180+
smart00656Amb_all4.0e-4870233179+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY99626.101269113400hypothetical protein OsI_21605 [Oryza sativa Indica Group]
RefSeqXP_001753505.1013155324predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_001761530.10131512330predicted protein [Physcomitrella patens subsp. patens]
RefSeqXP_002453531.101293117425hypothetical protein SORBIDRAFT_04g007450 [Sorghum bicolor]
RefSeqXP_002522747.10131568399Pectate lyase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B5.99756e-43126721309A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A5.99756e-43126721309A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pcl_A0.0000000000000036730575351A Chain A, Unusual Structural Features In The Parallel Beta-Helix In Pectate Lyases
PDB1vbl_A0.0000000000000267229127330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3zsc_A0.0000000000000762317248A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DC9506092161043150
BJ867600214933050
BJ867266214923040
JG594056167281940
HO5922711811323080
Orthologous Group
SpeciesID
Physcomitrella patensPp1s9_110V6.1
Picea abiesMA_20455g0010
Selaginella moellendorffii1153611360613694
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny