Basic Information | |
---|---|
Species | Arabidopsis lyrata |
Cazyme ID | 920460 |
Family | CBM43 |
Protein Properties | Length: 84 Molecular Weight: 9327.4 Isoelectric Point: 6.2086 |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 80 | 5.1e-27 |
TAKDEQLEDNIGFACANGVDCRPILPSGACFKPNTTISHASYLMNSYYEQHGRTNNSCFFFFPNSAMLTSTDPSYNHC |
Full Sequence |
---|
Protein Sequence Length: 84 Download |
MQTAKDEQLE DNIGFACANG VDCRPILPSG ACFKPNTTIS HASYLMNSYY EQHGRTNNSC 60 FFFFPNSAML TSTDPSYNHC IYK* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-14 | 3 | 62 | 65 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 3.0e-28 | 4 | 82 | 79 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK28052.1 | 8e-25 | 4 | 82 | 38 | 114 | unknown [Arabidopsis thaliana] |
GenBank | ABK28115.1 | 7e-25 | 4 | 82 | 36 | 112 | unknown [Arabidopsis thaliana] |
RefSeq | NP_001078361.1 | 7e-25 | 4 | 82 | 38 | 114 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001118954.1 | 7e-25 | 4 | 82 | 36 | 112 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001118955.1 | 8e-25 | 4 | 82 | 38 | 114 | unknown protein [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-21 | 6 | 80 | 22 | 94 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
ES929992 | 82 | 3 | 84 | 1e-34 |
ES929881 | 82 | 3 | 84 | 1e-34 |
GR726133 | 82 | 3 | 84 | 1e-34 |
EE519376 | 82 | 3 | 84 | 2e-34 |
EE519889 | 82 | 3 | 84 | 2e-34 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|