Basic Information | |
---|---|
Species | Medicago truncatula |
Cazyme ID | AC235758_14.1 |
Family | GT4 |
Protein Properties | Length: 208 Molecular Weight: 23103.7 Isoelectric Point: 7.558 |
Chromosome | Chromosome/Scaffold: 2357581 Start: 61710 End: 63614 |
Description | UDP-Glycosyltransferase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT4 | 11 | 170 | 2.1e-24 |
EIPVIISVAQFRPEKAHTLQLEAFSVAIKRLDSGLPKPKLQFVGSCRNKSDDERLQMLKTKAIELNVNELVEFHKNVTYRDLVGLLAGAIAGIHSMTDEH FGISVVEYMAAGAIPIAHNSAGPKMDIVLDEDEQQTGFLACTVEEYADAIYRVIKMSETE |
Full Sequence |
---|
Protein Sequence Length: 208 Download |
MQVLPLERSA EIPVIISVAQ FRPEKAHTLQ LEAFSVAIKR LDSGLPKPKL QFVGSCRNKS 60 DDERLQMLKT KAIELNVNEL VEFHKNVTYR DLVGLLAGAI AGIHSMTDEH FGISVVEYMA 120 AGAIPIAHNS AGPKMDIVLD EDEQQTGFLA CTVEEYADAI YRVIKMSETE RLKMAAAARR 180 RASRFSEQKF CDDFKAAVRP ILNRVSK* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
cd03805 | GT1_ALG2_like | 1.0e-16 | 13 | 194 | 188 | + This family is most closely related to the GT1 family of glycosyltransferases. ALG2, a 1,3-mannosyltransferase, in yeast catalyzes the mannosylation of Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. A deficiency of this enzyme causes an abnormal accumulation of Man1GlcNAc2-PP-dolichol and Man2GlcNAc2-PP-dolichol, which is associated with a type of congenital disorders of glycosylation (CDG), designated CDG-Ii, in humans. |
COG0438 | RfaG | 2.0e-18 | 4 | 204 | 203 | + Glycosyltransferase [Cell envelope biogenesis, outer membrane] |
pfam00534 | Glycos_transf_1 | 8.0e-20 | 13 | 171 | 161 | + Glycosyl transferases group 1. Mutations in this domain of human PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family. |
cd03806 | GT1_ALG11_like | 1.0e-84 | 4 | 190 | 188 | + This family is most closely related to the GT1 family of glycosyltransferases. ALG11 in yeast is involved in adding the final 1,2-linked Man to the Man5GlcNAc2-PP-Dol synthesized on the cytosolic face of the ER. The deletion analysis of ALG11 was shown to block the early steps of core biosynthesis that takes place on the cytoplasmic face of the ER and lead to a defect in the assembly of lipid-linked oligosaccharides. |
PLN02949 | PLN02949 | 2.0e-122 | 1 | 207 | 207 | + transferase, transferring glycosyl groups |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009058 | biosynthetic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAE99716.1 | 0 | 1 | 203 | 45 | 247 | hypothetical protein [Arabidopsis thaliana] |
DDBJ | BAF30163.2 | 0 | 1 | 203 | 33 | 235 | Os12g0583000 [Oryza sativa Japonica Group] |
RefSeq | NP_001067144.1 | 0 | 1 | 203 | 52 | 254 | Os12g0583000 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_181548.2 | 0 | 1 | 203 | 257 | 459 | glycosyl transferase family 1 protein [Arabidopsis thaliana] |
RefSeq | XP_002528312.1 | 0 | 1 | 207 | 259 | 465 | glycosyl transferase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2f9f_A | 0.000002 | 16 | 185 | 27 | 177 | A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a |
PDB | 3fro_C | 0.0005 | 109 | 204 | 341 | 433 | A Chain A, Crystal Structure Of Pyrococcus Abyssi Glycogen Synthase With Open And Closed Conformations |
PDB | 3fro_B | 0.0005 | 109 | 204 | 341 | 433 | A Chain A, Crystal Structure Of Pyrococcus Abyssi Glycogen Synthase With Open And Closed Conformations |
PDB | 3fro_A | 0.0005 | 109 | 204 | 341 | 433 | A Chain A, Crystal Structure Of Pyrococcus Abyssi Glycogen Synthase With Open And Closed Conformations |
PDB | 2bis_C | 0.0005 | 109 | 204 | 342 | 434 | A Chain A, Structure Of Glycogen Synthase From Pyrococcus Abyssi |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CO982175 | 205 | 1 | 205 | 0 |
CV529969 | 202 | 1 | 202 | 0 |
EC924723 | 206 | 1 | 206 | 0 |
GW958498 | 161 | 1 | 161 | 0 |
BQ510475 | 208 | 1 | 208 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |