Basic Information | |
---|---|
Species | Arabidopsis thaliana |
Cazyme ID | AT1G07890.6 |
Family | AA2 |
Protein Properties | Length: 250 Molecular Weight: 27520.2 Isoelectric Point: 6.2368 |
Chromosome | Chromosome/Scaffold: 1 Start: 2437330 End: 2439665 |
Description | OsAPx2 - Cytosolic Ascorbate Peroxidase encoding gene 4,5,6,8, expressed |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 25 | 246 | 0 |
GLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTMRFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGREDKPQ PPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWTSNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPLVEKY AADEDAFFADYAEAHMKLSELG |
Full Sequence |
---|
Protein Sequence Length: 250 Download |
MTKNYPTVSE DYKKAVEKCR RKLRGLIAEK NCAPIMVRLA WHSAGTFDCQ SRTGGPFGTM 60 RFDAEQAHGA NSGIHIALRL LDPIREQFPT ISFADFHQLA GVVAVEVTGG PDIPFHPGRE 120 DKPQPPPEGR LPDATKGCDH LRDVFAKQMG LSDKDIVALS GAHTLGRCHK DRSGFEGAWT 180 SNPLIFDNSY FKELLSGEKE GLLQLVSDKA LLDDPVFRPL VEKYAADEDA FFADYAEAHM 240 KLSELGYLS* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00314 | plant_peroxidase_like | 3.0e-43 | 23 | 223 | 229 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN02608 | PLN02608 | 7.0e-116 | 6 | 247 | 242 | + L-ascorbate peroxidase | ||
PLN02879 | PLN02879 | 4.0e-121 | 1 | 247 | 247 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 4.0e-131 | 5 | 246 | 250 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN02364 | PLN02364 | 9.0e-162 | 1 | 249 | 249 | + L-ascorbate peroxidase 1 |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0000302 | response to reactive oxygen species |
GO:0004601 | peroxidase activity |
GO:0005618 | cell wall |
GO:0005829 | cytosol |
GO:0005886 | plasma membrane |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAN60794.1 | 0 | 1 | 247 | 1 | 247 | ascorbate peroxidase [Brassica juncea] |
GenBank | AAN60795.1 | 0 | 1 | 247 | 1 | 247 | ascorbate peroxidase [Brassica juncea] |
DDBJ | BAB84009.1 | 0 | 1 | 247 | 1 | 247 | ascorbate peroxidase [Brassica oleracea] |
RefSeq | NP_001077481.1 | 0 | 1 | 249 | 1 | 249 | APX1 (ascorbate peroxidase 1); L-ascorbate peroxidase [Arabidopsis thaliana] |
RefSeq | NP_172267.1 | 0 | 1 | 247 | 1 | 247 | APX1 (ascorbate peroxidase 1); L-ascorbate peroxidase [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1apx_D | 0 | 3 | 247 | 2 | 246 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_C | 0 | 3 | 247 | 2 | 246 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_B | 0 | 3 | 247 | 2 | 246 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_A | 0 | 3 | 247 | 2 | 246 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 2ghk_X | 0 | 3 | 247 | 14 | 258 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
ascorbate glutathione cycle | RXN-3521 | - | L-ascorbate peroxidase |
L-ascorbate degradation III | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
L-ascorbate degradation V | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EG494540 | 247 | 1 | 247 | 0 |
CF651760 | 247 | 1 | 247 | 0 |
CF652474 | 247 | 1 | 247 | 0 |
DY902145 | 247 | 1 | 247 | 0 |
JZ151642 | 247 | 1 | 247 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|