| Basic Information | |
|---|---|
| Species | Arabidopsis thaliana |
| Cazyme ID | AT1G66855.1 |
| Family | CBM43 |
| Protein Properties | Length: 112 Molecular Weight: 12408.1 Isoelectric Point: 6.0607 |
| Chromosome | Chromosome/Scaffold: 1 Start: 24939550 End: 24940013 |
| Description | glucan endo-1,3-beta-glucosidase precursor, putative, expressed |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 26 | 108 | 5e-32 |
| WCVAAASATDTQLQANIDWACNEGKVDCVKINPGGVCYEPNTLTSHASFVMNDYYRNHGSIEEACEFNHTGQIISGDPSYRRC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 112 Download |
| MISQLTLIFF LSLVVIQPFH ILAKTWCVAA ASATDTQLQA NIDWACNEGK VDCVKINPGG 60 VCYEPNTLTS HASFVMNDYY RNHGSIEEAC EFNHTGQIIS GDPSYRRCRY S* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 3.0e-19 | 25 | 96 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-36 | 25 | 110 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003674 | molecular_function |
| GO:0008150 | biological_process |
| GO:0012505 | endomembrane system |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_001031243.1 | 0 | 1 | 111 | 1 | 111 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_001117561.1 | 0 | 1 | 111 | 1 | 110 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_001118955.1 | 2e-31 | 3 | 111 | 6 | 115 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_176859.1 | 0 | 1 | 111 | 1 | 111 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| RefSeq | NP_974558.1 | 0 | 1 | 111 | 1 | 111 | Expressed protein [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 2e-22 | 18 | 110 | 5 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
