Basic Information | |
---|---|
Species | Arabidopsis thaliana |
Cazyme ID | AT1G66855.1 |
Family | CBM43 |
Protein Properties | Length: 112 Molecular Weight: 12408.1 Isoelectric Point: 6.0607 |
Chromosome | Chromosome/Scaffold: 1 Start: 24939550 End: 24940013 |
Description | glucan endo-1,3-beta-glucosidase precursor, putative, expressed |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 26 | 108 | 5e-32 |
WCVAAASATDTQLQANIDWACNEGKVDCVKINPGGVCYEPNTLTSHASFVMNDYYRNHGSIEEACEFNHTGQIISGDPSYRRC |
Full Sequence |
---|
Protein Sequence Length: 112 Download |
MISQLTLIFF LSLVVIQPFH ILAKTWCVAA ASATDTQLQA NIDWACNEGK VDCVKINPGG 60 VCYEPNTLTS HASFVMNDYY RNHGSIEEAC EFNHTGQIIS GDPSYRRCRY S* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-19 | 25 | 96 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-36 | 25 | 110 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003674 | molecular_function |
GO:0008150 | biological_process |
GO:0012505 | endomembrane system |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_001031243.1 | 0 | 1 | 111 | 1 | 111 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001117561.1 | 0 | 1 | 111 | 1 | 110 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001118955.1 | 2e-31 | 3 | 111 | 6 | 115 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_176859.1 | 0 | 1 | 111 | 1 | 111 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_974558.1 | 0 | 1 | 111 | 1 | 111 | Expressed protein [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-22 | 18 | 110 | 5 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |