Basic Information | |
---|---|
Species | Arabidopsis thaliana |
Cazyme ID | AT2G04910.1 |
Family | CBM43 |
Protein Properties | Length: 125 Molecular Weight: 13856.6 Isoelectric Point: 4.5204 |
Chromosome | Chromosome/Scaffold: 2 Start: 1723980 End: 1724354 |
Description | glucan endo-1,3-beta-glucosidase precursor, putative, expressed |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 15 | 94 | 1.7e-30 |
WCVADGQIPDNVIQAAVDWACQTGGADCSTIQPNQPCFLPNTVKDHASVVFNNYYQRYKRNGGSCNFNSTAFITQTDPSK |
Full Sequence |
---|
Protein Sequence Length: 125 Download |
MGYLIFVAKA EFGQWCVADG QIPDNVIQAA VDWACQTGGA DCSTIQPNQP CFLPNTVKDH 60 ASVVFNNYYQ RYKRNGGSCN FNSTAFITQT DPSKQLYLNP FCYSYLSSLI NQNLEPSVSD 120 YLMI* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-17 | 14 | 85 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 5.0e-32 | 14 | 93 | 80 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003674 | molecular_function |
GO:0008150 | biological_process |
GO:0012505 | endomembrane system |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAN67352.1 | 6e-35 | 8 | 92 | 22 | 106 | hypothetical protein [Vitis vinifera] |
EMBL | CBI28425.1 | 2e-35 | 8 | 93 | 22 | 107 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001154494.1 | 0 | 1 | 94 | 1 | 94 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_178568.1 | 0 | 1 | 124 | 1 | 124 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002269977.1 | 1e-36 | 6 | 95 | 1237 | 1326 | PREDICTED: hypothetical protein [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 5e-17 | 13 | 93 | 11 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EE090966 | 98 | 1 | 93 | 2e-35 |
DT035040 | 86 | 8 | 93 | 3e-35 |
DK539002 | 87 | 8 | 93 | 5e-35 |
DK479406 | 87 | 8 | 93 | 5e-35 |
FG891416 | 90 | 4 | 93 | 6e-35 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|