| Basic Information | |
|---|---|
| Species | Arabidopsis thaliana |
| Cazyme ID | AT2G04910.1 |
| Family | CBM43 |
| Protein Properties | Length: 125 Molecular Weight: 13856.6 Isoelectric Point: 4.5204 |
| Chromosome | Chromosome/Scaffold: 2 Start: 1723980 End: 1724354 |
| Description | glucan endo-1,3-beta-glucosidase precursor, putative, expressed |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 15 | 94 | 1.7e-30 |
| WCVADGQIPDNVIQAAVDWACQTGGADCSTIQPNQPCFLPNTVKDHASVVFNNYYQRYKRNGGSCNFNSTAFITQTDPSK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 125 Download |
| MGYLIFVAKA EFGQWCVADG QIPDNVIQAA VDWACQTGGA DCSTIQPNQP CFLPNTVKDH 60 ASVVFNNYYQ RYKRNGGSCN FNSTAFITQT DPSKQLYLNP FCYSYLSSLI NQNLEPSVSD 120 YLMI* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 4.0e-17 | 14 | 85 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 5.0e-32 | 14 | 93 | 80 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003674 | molecular_function |
| GO:0008150 | biological_process |
| GO:0012505 | endomembrane system |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN67352.1 | 6e-35 | 8 | 92 | 22 | 106 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI28425.1 | 2e-35 | 8 | 93 | 22 | 107 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_001154494.1 | 0 | 1 | 94 | 1 | 94 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| RefSeq | NP_178568.1 | 0 | 1 | 124 | 1 | 124 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| RefSeq | XP_002269977.1 | 1e-36 | 6 | 95 | 1237 | 1326 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 5e-17 | 13 | 93 | 11 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EE090966 | 98 | 1 | 93 | 2e-35 |
| DT035040 | 86 | 8 | 93 | 3e-35 |
| DK539002 | 87 | 8 | 93 | 5e-35 |
| DK479406 | 87 | 8 | 93 | 5e-35 |
| FG891416 | 90 | 4 | 93 | 6e-35 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
