Basic Information | |
---|---|
Species | Arabidopsis thaliana |
Cazyme ID | AT2G04910.2 |
Family | CBM43 |
Protein Properties | Length: 105 Molecular Weight: 11579.9 Isoelectric Point: 4.8475 |
Chromosome | Chromosome/Scaffold: 2 Start: 1723939 End: 1724354 |
Description | glucan endo-1,3-beta-glucosidase precursor, putative, expressed |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 15 | 98 | 2.3e-32 |
WCVADGQIPDNVIQAAVDWACQTGGADCSTIQPNQPCFLPNTVKDHASVVFNNYYQRYKRNGGSCNFNSTAFITQTDPSHDSCH |
Full Sequence |
---|
Protein Sequence Length: 105 Download |
MGYLIFVAKA EFGQWCVADG QIPDNVIQAA VDWACQTGGA DCSTIQPNQP CFLPNTVKDH 60 ASVVFNNYYQ RYKRNGGSCN FNSTAFITQT DPSHDSCHFE YVPF* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-17 | 14 | 85 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-35 | 14 | 99 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003674 | molecular_function |
GO:0008150 | biological_process |
GO:0012505 | endomembrane system |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI28425.1 | 1.00053e-42 | 8 | 103 | 22 | 117 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_001154494.1 | 0 | 1 | 104 | 1 | 104 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_178568.1 | 0 | 1 | 94 | 1 | 94 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002321180.1 | 2e-39 | 8 | 103 | 22 | 117 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002522909.1 | 5e-40 | 4 | 103 | 12 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-19 | 13 | 99 | 11 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EE090966 | 108 | 1 | 103 | 4.99983e-42 |
DT035040 | 96 | 8 | 103 | 1.99993e-41 |
DK539002 | 97 | 8 | 103 | 1.99993e-41 |
DK479406 | 97 | 8 | 103 | 1.99993e-41 |
DK457624 | 97 | 8 | 103 | 3.00004e-41 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|