| Basic Information | |
|---|---|
| Species | Arabidopsis thaliana |
| Cazyme ID | AT2G39630.2 |
| Family | GT2 |
| Protein Properties | Length: 237 Molecular Weight: 26499.4 Isoelectric Point: 5.4145 |
| Chromosome | Chromosome/Scaffold: 2 Start: 16521744 End: 16524687 |
| Description | dolichyl-phosphate beta-glycosyltransferase, putative, expressed |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GT2 | 69 | 205 | 1.2e-31 |
| SLIVPAYNEELRLPAALEETMDYLQDRASRDKSFSFEVVIVDDGSVDGTKRVAFDFIRKYTIDNIRVIPLGKNQGKGEAIRKGMLHSRGQLLLMLDADGA TKVTDLEKLENQINAVAREEYSIRNPASKDMDFKIGD | |||
| Full Sequence |
|---|
| Protein Sequence Length: 237 Download |
| MEFLVTVAEF SLWLLLIVLF GFLSVVVFEA WRRRHSNVSV ETVTTLDDPK SIKPIPCPHI 60 TDPAEKYLSL IVPAYNEELR LPAALEETMD YLQDRASRDK SFSFEVVIVD DGSVDGTKRV 120 AFDFIRKYTI DNIRVIPLGK NQGKGEAIRK GMLHSRGQLL LMLDADGATK VTDLEKLENQ 180 INAVAREEYS IRNPASKDMD FKIGDVQVSA FGSRAHLEEK ALATSFNFRG NGIATF* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00761 | Glyco_tranf_GTA_type | 7.0e-17 | 71 | 177 | 107 | + Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities. | ||
| pfam00535 | Glycos_transf_2 | 2.0e-21 | 69 | 191 | 123 | + Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids. | ||
| cd04179 | DPM_DPG-synthase_like | 1.0e-30 | 70 | 236 | 167 | + DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily. | ||
| PTZ00260 | PTZ00260 | 1.0e-41 | 60 | 228 | 182 | + dolichyl-phosphate beta-glucosyltransferase; Provisional | ||
| cd04188 | DPG_synthase | 4.0e-51 | 70 | 224 | 155 | + DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005783 | endoplasmic reticulum |
| GO:0006486 | protein glycosylation |
| GO:0009058 | biosynthetic process |
| GO:0016757 | transferase activity, transferring glycosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_181493.1 | 0 | 32 | 229 | 32 | 229 | glycosyl transferase family 2 protein [Arabidopsis thaliana] |
| RefSeq | NP_850318.1 | 0 | 32 | 236 | 32 | 236 | glycosyl transferase family 2 protein [Arabidopsis thaliana] |
| RefSeq | XP_002283615.1 | 0 | 30 | 229 | 30 | 230 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002312095.1 | 0 | 30 | 229 | 30 | 229 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002315224.1 | 0 | 31 | 229 | 31 | 229 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3l7m_D | 0.00001 | 68 | 217 | 4 | 145 | A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a |
| PDB | 3l7m_C | 0.00001 | 68 | 217 | 4 | 145 | A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a |
| PDB | 3l7m_B | 0.00001 | 68 | 217 | 4 | 145 | A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a |
| PDB | 3l7m_A | 0.00001 | 68 | 217 | 4 | 145 | A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a |
| PDB | 3l7l_D | 0.00001 | 68 | 217 | 4 | 145 | A Chain A, Structure Of The Wall Teichoic Acid Polymerase Tagf, H548a |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| dolichyl-diphosphooligosaccharide biosynthesis | 2.4.1.117-RXN | EC-2.4.1.117 | dolichyl-phosphate β-glucosyltransferase |
