| Basic Information | |
|---|---|
| Species | Arabidopsis thaliana |
| Cazyme ID | AT2G42930.1 |
| Family | CBM43 |
| Protein Properties | Length: 135 Molecular Weight: 14995.9 Isoelectric Point: 8.462 |
| Chromosome | Chromosome/Scaffold: 2 Start: 17860868 End: 17861272 |
| Description | X8 domain containing protein, expressed |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 40 | 118 | 1.2e-26 |
| WCMENPYAYFRRVISSLKWACKNGADCSPLEKGGRCQDLDNYRSQASYAFNDYYQKNPIPRNCDFNGAAVLTVQDPSNT | |||
| Full Sequence |
|---|
| Protein Sequence Length: 135 Download |
| MKTKMLITLF ALVSVAGTSE ATGTLAAQQN TSIIPTYTLW CMENPYAYFR RVISSLKWAC 60 KNGADCSPLE KGGRCQDLDN YRSQASYAFN DYYQKNPIPR NCDFNGAAVL TVQDPSNTKH 120 FTFEKIKPTS DQNS* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 2.0e-12 | 39 | 109 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 2.0e-24 | 39 | 117 | 80 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003674 | molecular_function |
| GO:0008150 | biological_process |
| GO:0012505 | endomembrane system |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACG38222.1 | 1e-18 | 40 | 117 | 104 | 181 | GPI-anchored protein [Zea mays] |
| RefSeq | NP_001142053.1 | 2e-18 | 40 | 117 | 116 | 193 | hypothetical protein LOC100274209 [Zea mays] |
| RefSeq | NP_181821.1 | 0 | 1 | 134 | 1 | 134 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| RefSeq | XP_002441577.1 | 5e-20 | 40 | 118 | 74 | 153 | hypothetical protein SORBIDRAFT_09g029700 [Sorghum bicolor] |
| RefSeq | XP_002519744.1 | 7e-18 | 40 | 121 | 115 | 198 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 0.0000000003 | 40 | 116 | 13 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
| Signal Peptide | |||||
|---|---|---|---|---|---|
| Cleavage Site | |||||
| 21 | |||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CK195227 | 98 | 40 | 130 | 3e-23 |
| CK200559 | 80 | 40 | 119 | 1e-20 |
| BE358995 | 80 | 40 | 118 | 4e-20 |
| FL921534 | 80 | 40 | 118 | 4e-19 |
| GE554486 | 71 | 40 | 109 | 5e-19 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Arabidopsis lyrata | 903671 | ||||
| Capsella rubella | Carubv10024927m | ||||
| Glycine max | Glyma15g23435.2 | ||||
| Sequence Alignments |
|---|
 |
| Phylogeny |
|---|
 |