Basic Information | |
---|---|
Species | Arabidopsis thaliana |
Cazyme ID | AT2G43660.1 |
Family | CBM43 |
Protein Properties | Length: 123 Molecular Weight: 13421.4 Isoelectric Point: 6.9742 |
Chromosome | Chromosome/Scaffold: 2 Start: 18103752 End: 18104581 |
Description | X8 domain containing protein, expressed |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 34 | 116 | 1.2e-26 |
WCVAKPGTPIKQLVKNLNNVCSNSSVHCEVVSEGGACYDPINLYNSASVVMNLYYQNQGRQYSKCDFEGSGIISVTDPSYECC |
Full Sequence |
---|
Protein Sequence Length: 123 Download |
MPKAQIWFPF IILLCISSGS FMRVNAQAPG QGSWCVAKPG TPIKQLVKNL NNVCSNSSVH 60 CEVVSEGGAC YDPINLYNSA SVVMNLYYQN QGRQYSKCDF EGSGIISVTD PSYECCIYEF 120 AK* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 1.0e-13 | 33 | 105 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 5.0e-28 | 33 | 118 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003674 | molecular_function |
GO:0008150 | biological_process |
GO:0012505 | endomembrane system |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAB64040.1 | 0 | 1 | 112 | 1 | 113 | putative beta-1,3-glucanase, C terminal fragment [Arabidopsis thaliana] |
GenBank | AAT41831.1 | 2e-32 | 4 | 122 | 3 | 120 | At2g43670 [Arabidopsis thaliana] |
RefSeq | NP_181895.2 | 1e-34 | 1 | 122 | 1 | 121 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_850398.1 | 0 | 1 | 122 | 1 | 122 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_973680.1 | 0 | 1 | 122 | 1 | 123 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 8e-19 | 32 | 118 | 11 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |