Basic Information | |
---|---|
Species | Arabidopsis thaliana |
Cazyme ID | AT3G07380.1 |
Family | GT92 |
Protein Properties | Length: 103 Molecular Weight: 11972.8 Isoelectric Point: 8.4442 |
Chromosome | Chromosome/Scaffold: 3 Start: 2360988 End: 2362014 |
Description | expressed protein |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT92 | 2 | 99 | 1.7e-24 |
TKWMFFVDVDEFLHVPVKETISSVMESLEEYFQFTIELMPMSSQVCYSGDGPARTYRKWGIEKLAYRDVKKVPRRDRKYAVQPENVFAIGVHMSQNLQ |
Full Sequence |
---|
Protein Sequence Length: 103 Download |
MTKWMFFVDV DEFLHVPVKE TISSVMESLE EYFQFTIELM PMSSQVCYSG DGPARTYRKW 60 GIEKLAYRDV KKVPRRDRKY AVQPENVFAI GVHMSQNLQG KT* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam13704 | Glyco_tranf_2_4 | 0.007 | 3 | 26 | 25 | + Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, | ||
pfam01697 | Glyco_transf_92 | 0.002 | 3 | 102 | 107 | + Glycosyltransferase family 92. Members of this family act as galactosyltransferases, belonging to glycosyltransferase family 92. The aligned region contains several conserved cysteine residues and several charged residues that may be catalytic residues. This is supported by the inclusion of this family in the GT-A glycosyl transferase superfamily. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003674 | molecular_function |
GO:0008150 | biological_process |
GO:0012505 | endomembrane system |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAL24253.1 | 0 | 1 | 102 | 217 | 318 | AT4g20170/F1C12_90 [Arabidopsis thaliana] |
RefSeq | NP_187394.1 | 0 | 1 | 102 | 1 | 102 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_191658.1 | 0 | 1 | 102 | 1 | 102 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_193750.1 | 0 | 1 | 102 | 333 | 434 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_199280.1 | 0 | 1 | 102 | 348 | 449 | unknown protein [Arabidopsis thaliana] |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
AV523967 | 99 | 5 | 103 | 0 |
EG501188 | 102 | 1 | 102 | 0 |
EX063129 | 101 | 2 | 102 | 0 |
DN776604 | 101 | 2 | 102 | 0 |
DK549158 | 101 | 2 | 102 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|