Basic Information | |
---|---|
Species | Arabidopsis thaliana |
Cazyme ID | AT3G28250.1 |
Family | CBM43 |
Protein Properties | Length: 122 Molecular Weight: 13875 Isoelectric Point: 4.5119 |
Chromosome | Chromosome/Scaffold: 3 Start: 10533324 End: 10533689 |
Description | X8 domain containing protein, expressed |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 3 | 79 | 7.6e-26 |
WCVAKPGTLTEQLINNLNYACSIVDCQIISTRGACYSPDNIYNMASVVMNLYYQAEGRNFWNCNFGDSGLVAITDPS |
Full Sequence |
---|
Protein Sequence Length: 122 Download |
MQWCVAKPGT LTEQLINNLN YACSIVDCQI ISTRGACYSP DNIYNMASVV MNLYYQAEGR 60 NFWNCNFGDS GLVAITDPSE FYLSLLFHYT IIYVLFFCLI SNYFCFRQAM EVANMNFVCK 120 A* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 7.0e-13 | 2 | 71 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 4.0e-27 | 2 | 79 | 79 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003674 | molecular_function |
GO:0005575 | cellular_component |
GO:0008150 | biological_process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAB64039.1 | 5e-34 | 2 | 87 | 34 | 119 | putative beta-1,3-glucanase, C terminal fragment [Arabidopsis thaliana] |
GenBank | AAT41831.1 | 1e-31 | 3 | 89 | 34 | 118 | At2g43670 [Arabidopsis thaliana] |
DDBJ | BAB02616.1 | 0 | 1 | 121 | 34 | 154 | beta-1,3-glucanase-like protein [Arabidopsis thaliana] |
RefSeq | NP_181895.2 | 9e-32 | 3 | 89 | 35 | 119 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_189465.1 | 0 | 1 | 121 | 1 | 121 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 3e-21 | 3 | 79 | 13 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |