Basic Information | |
---|---|
Species | Arabidopsis thaliana |
Cazyme ID | AT4G05430.1 |
Family | CBM43 |
Protein Properties | Length: 144 Molecular Weight: 15843.8 Isoelectric Point: 7.7668 |
Chromosome | Chromosome/Scaffold: 4 Start: 2753582 End: 2754420 |
Description | glucan endo-1,3-beta-glucosidase precursor, putative, expressed |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 23 | 106 | 1.1e-33 |
WCVARPGATQAELQRALDWACGIGRVDCSVIERHGDCYEPDTIVSHASFAFNAYYQTNGNNRIACYFGGTATFTKINPSYGKCS |
Full Sequence |
---|
Protein Sequence Length: 144 Download |
MTIRPESLVG PQGNTTFLEG TTWCVARPGA TQAELQRALD WACGIGRVDC SVIERHGDCY 60 EPDTIVSHAS FAFNAYYQTN GNNRIACYFG GTATFTKINP SYGKCSYDAS KSEVSTARSL 120 SEYKARWLLL MYIGVFSLIS RRD* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 7.0e-21 | 22 | 94 | 82 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-40 | 22 | 107 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003674 | molecular_function |
GO:0005575 | cellular_component |
GO:0008150 | biological_process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACJ85566.1 | 0 | 7 | 137 | 41 | 174 | unknown [Medicago truncatula] |
GenBank | ACU17215.1 | 0 | 3 | 117 | 34 | 148 | unknown [Glycine max] |
EMBL | CAB81085.1 | 0 | 1 | 101 | 1 | 101 | putative protein [Arabidopsis thaliana] |
EMBL | CBI30973.1 | 0 | 7 | 127 | 586 | 706 | unnamed protein product [Vitis vinifera] |
RefSeq | NP_192452.2 | 0 | 1 | 143 | 1 | 143 | unknown protein [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 2e-20 | 22 | 107 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CF652466 | 101 | 1 | 101 | 0 |
DT019806 | 118 | 7 | 124 | 0 |
DT039619 | 118 | 7 | 124 | 0 |
DT019261 | 118 | 7 | 124 | 0 |
CF652466 | 36 | 109 | 144 | 0.00000000002 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|