| Basic Information | |
|---|---|
| Species | Arabidopsis thaliana |
| Cazyme ID | AT4G09090.1 |
| Family | CBM43 |
| Protein Properties | Length: 117 Molecular Weight: 12442.4 Isoelectric Point: 8.8355 |
| Chromosome | Chromosome/Scaffold: 4 Start: 5807220 End: 5807710 |
| Description | glucan endo-1,3-beta-glucosidase precursor, putative, expressed |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 31 | 112 | 3.8e-31 |
| WCVAKMNATNAQLQGNINFGCSEGVDCGPIQPGGSCYIPNSLVNHASFVMNAYYQSHGRTKKACSFKNTGTFAVTDLSFGKC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 117 Download |
| MAKISSLLAL LFIILSSIMI NHLHVASSTK WCVAKMNATN AQLQGNINFG CSEGVDCGPI 60 QPGGSCYIPN SLVNHASFVM NAYYQSHGRT KKACSFKNTG TFAVTDLSFG KCVYVS* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 2.0e-22 | 30 | 101 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 1.0e-35 | 30 | 114 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003674 | molecular_function |
| GO:0008150 | biological_process |
| GO:0012505 | endomembrane system |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK28052.1 | 0 | 1 | 116 | 1 | 116 | unknown [Arabidopsis thaliana] |
| RefSeq | NP_001078361.1 | 0 | 1 | 116 | 1 | 116 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_001118955.1 | 0 | 1 | 116 | 1 | 116 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_001118956.1 | 0 | 1 | 116 | 1 | 116 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_192648.2 | 0 | 1 | 116 | 1 | 116 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 3e-28 | 31 | 116 | 13 | 98 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
