y
Basic Information | |
---|---|
Species | Arabidopsis thaliana |
Cazyme ID | AT4G09466.1 |
Family | CBM43 |
Protein Properties | Length: 117 Molecular Weight: 12592.5 Isoelectric Point: 8.8564 |
Chromosome | Chromosome/Scaffold: 4 Start: 6003632 End: 6004167 |
Description | X8 domain containing protein, expressed |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 31 | 112 | 1.7e-30 |
WCIATLIATNAQLQANINFACSQGVDCRPIRPDGSCFIPNNLANHASFVMNSYYQTHGRTNQICSFKNTGTFAATNPSFGKC |
Full Sequence |
---|
Protein Sequence Length: 117 Download |
MAKISSPLAL LFIMLSSIMI NHIHVASSKT WCIATLIATN AQLQANINFA CSQGVDCRPI 60 RPDGSCFIPN NLANHASFVM NSYYQTHGRT NQICSFKNTG TFAATNPSFG KCVYAS* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-20 | 30 | 101 | 77 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 7.0e-34 | 30 | 114 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0003674 | molecular_function |
GO:0008150 | biological_process |
GO:0012505 | endomembrane system |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK28052.1 | 0 | 1 | 116 | 1 | 116 | unknown [Arabidopsis thaliana] |
RefSeq | NP_001078361.1 | 0 | 1 | 116 | 1 | 116 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001118954.1 | 0 | 1 | 116 | 1 | 114 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001118955.1 | 0 | 1 | 116 | 1 | 116 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_001118956.1 | 0 | 1 | 116 | 1 | 116 | unknown protein [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 1e-26 | 27 | 116 | 9 | 98 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |