Basic Information | |
---|---|
Species | Arabidopsis thaliana |
Cazyme ID | AT4G38310.1 |
Family | GT34 |
Protein Properties | Length: 121 Molecular Weight: 13902.9 Isoelectric Point: 7.7028 |
Chromosome | Chromosome/Scaffold: 4 Start: 17948482 End: 17948844 |
Description | glycosyltransferase, putative, expressed |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT34 | 47 | 117 | 1.6e-29 |
NRILMVTGSQSSPCKNPIGDHLLLLRCFKNKVDYARIHGHDIFYSNSLLHPKMNSYWAKLPVVKAAMLAHP |
Full Sequence |
---|
Protein Sequence Length: 121 Download |
MQLDPPEPGF YDDPDLSYSI EKSITNWDEK RHEWFKSHPS FKPGSENRIL MVTGSQSSPC 60 KNPIGDHLLL LRCFKNKVDY ARIHGHDIFY SNSLLHPKMN SYWAKLPVVK AAMLAHPFMD 120 * |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam05637 | Glyco_transf_34 | 5.0e-27 | 46 | 117 | 74 | + galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologues where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34. | ||
PLN03182 | PLN03182 | 2.0e-40 | 13 | 117 | 107 | + xyloglucan 6-xylosyltransferase; Provisional | ||
PLN03181 | PLN03181 | 2.0e-80 | 1 | 117 | 117 | + glycosyltransferase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008150 | biological_process |
GO:0016021 | integral to membrane |
GO:0016757 | transferase activity, transferring glycosyl groups |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_195544.1 | 0 | 1 | 120 | 1 | 120 | galactosyl transferase GMA12/MNN10 family protein [Arabidopsis thaliana] |
RefSeq | NP_565544.1 | 0 | 1 | 117 | 77 | 192 | galactosyl transferase GMA12/MNN10 family protein [Arabidopsis thaliana] |
RefSeq | NP_680773.1 | 0 | 1 | 117 | 60 | 175 | galactosyl transferase GMA12/MNN10 family protein [Arabidopsis thaliana] |
RefSeq | XP_002310890.1 | 0 | 1 | 117 | 84 | 199 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002320005.1 | 0 | 1 | 117 | 85 | 200 | predicted protein [Populus trichocarpa] |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
xyloglucan biosynthesis | RXN-12415 | EC-2.4.2.39 | xyloglucan 6-xylosyltransferase |
xyloglucan biosynthesis | RXN-9461 | EC-2.4.2.39 | xyloglucan 6-xylosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
AU235661 | 117 | 1 | 117 | 0 |
AV442141 | 117 | 1 | 117 | 0 |
DR279389 | 100 | 22 | 121 | 0 |
EX018809 | 117 | 1 | 117 | 0 |
EG494662 | 117 | 1 | 117 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|