| Basic Information | |
|---|---|
| Species | Arabidopsis thaliana |
| Cazyme ID | AT5G01260.1 |
| Family | CBM20 |
| Protein Properties | Length: 307 Molecular Weight: 34179.4 Isoelectric Point: 4.1362 |
| Chromosome | Chromosome/Scaffold: 5 Start: 105325 End: 107405 |
| Description | starch binding domain containing protein, putative, expressed |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM20 | 87 | 174 | 1.9e-24 |
| VRVRFQLRKECVFGEHFFIVGDDPVFGGLWDPETALPLNWSDGNVWTVDLDLPVGRLVEFKLLLKAQTGEILWQPGPNRALETWETNK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 307 Download |
| MIGIGRTLTS SSPSKIILED LPPGIYRYGT EIFTSVPRKT FHHIKFLRLD SAQSSRILKP 60 VPLRSSSIKD SQVNVEDEEI EASNKTVRVR FQLRKECVFG EHFFIVGDDP VFGGLWDPET 120 ALPLNWSDGN VWTVDLDLPV GRLVEFKLLL KAQTGEILWQ PGPNRALETW ETNKTIRICE 180 DWDNADLQMM IEEDFVPYTN ISSIGSEDED EVLGSVQQNS SVVAVENAGY VSDESAQNSS 240 FSIQSEKTME PSNGALTARE VIKEAMFTEE ESPVLVPGLI PLSDLDNEQV EVINEGKAET 300 FPEVIT* 360 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd02861 | E_set_pullulanase_like | 8.0e-14 | 89 | 179 | 100 | + Early set domain associated with the catalytic domain of pullulanase-like proteins. E or "early" set domains are associated with the catalytic domain of pullulanase at either the N-terminal or C-terminal end, and in a few instances at both ends. Pullulanase (also called dextrinase or alpha-dextrin endo-1,6-alpha glucosidase) is an enzyme with action similar to that of isoamylase; it cleaves 1,6-alpha-glucosidic linkages in pullulan, amylopectin, and glycogen, and in alpha-and beta-amylase limit-dextrins of amylopectin and glycogen. The E set domain of pullulanase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, isoamylase, and the beta subunit of AMP-activated protein kinase. | ||
| cd02856 | E_set_GDE_Isoamylase_N | 6.0e-16 | 82 | 175 | 98 | + N-terminal Early set domain associated with the catalytic domain of Glycogen debranching enzyme and bacterial isoamylase (also called glycogen 6-glucanohydrolase). E or "early" set domains are associated with the catalytic domain of the glycogen debranching enzyme at the N-terminal end. Glycogen debranching enzymes have both 4-alpha-glucanotransferase and amylo-1,6-glucosidase activities. As a transferase, it transfers a segment of the 1,4-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or another 1,4-alpha-D-glucan. As a glucosidase, it catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Bacterial isoamylases are also included in this subfamily. Isoamylase is one of the starch-debranching enzymes that catalyze the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen. Isoamylase contains a bound calcium ion, but this is not in the same position as the conserved calcium ion that has been reported in other alpha-amylase family enzymes. The N-terminal domain of glycogen debranching enzyme may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others. | ||
| smart01065 | CBM_2 | 2.0e-18 | 87 | 171 | 89 | + Starch binding domain. | ||
| pfam00686 | CBM_20 | 4.0e-19 | 86 | 175 | 93 | + Starch binding domain. | ||
| cd05467 | CBM20 | 3.0e-27 | 88 | 182 | 98 | + The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003824 | catalytic activity |
| GO:0005575 | cellular_component |
| GO:0005975 | carbohydrate metabolic process |
| GO:0030246 | carbohydrate binding |
| GO:2001070 | starch binding |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI30404.1 | 0 | 59 | 296 | 51 | 285 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_568087.1 | 0 | 1 | 306 | 1 | 306 | glycoside hydrolase starch-binding domain-containing protein [Arabidopsis thaliana] |
| RefSeq | NP_974720.1 | 0 | 1 | 304 | 1 | 304 | glycoside hydrolase starch-binding domain-containing protein [Arabidopsis thaliana] |
| RefSeq | XP_002322974.1 | 2.00386e-43 | 6 | 276 | 2 | 278 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002528119.1 | 5.60519e-45 | 85 | 259 | 18 | 174 | catalytic, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1cyg_A | 0.0000009 | 83 | 184 | 576 | 680 | A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase) |
| PDB | 1v3m_B | 0.00002 | 63 | 182 | 563 | 684 | A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase) |
| PDB | 1v3m_A | 0.00002 | 63 | 182 | 563 | 684 | A Chain A, Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase) |
| PDB | 1v3k_B | 0.00002 | 63 | 182 | 563 | 684 | A Chain A, Crystal Structure Of F283y Mutant Cyclodextrin Glycosyltransferase |
| PDB | 1v3k_A | 0.00002 | 63 | 182 | 563 | 684 | A Chain A, Crystal Structure Of F283y Mutant Cyclodextrin Glycosyltransferase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| ES903445 | 262 | 14 | 240 | 0 |
| GR452918 | 254 | 9 | 227 | 0 |
| DK475629 | 263 | 4 | 226 | 0 |
| ES936597 | 202 | 4 | 198 | 0 |
| GR437087 | 190 | 14 | 198 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
