| Basic Information | |
|---|---|
| Species | Arabidopsis thaliana |
| Cazyme ID | AT5G35740.1 |
| Family | CBM43 |
| Protein Properties | Length: 120 Molecular Weight: 13398.1 Isoelectric Point: 4.4665 |
| Chromosome | Chromosome/Scaffold: 5 Start: 13910418 End: 13911160 |
| Description | X8 domain containing protein, expressed |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 30 | 114 | 1.4e-33 |
| WCIADEQTPDDELQAALDWACGKGGADCSKMQQENQPCFLPNTIRDHASFAFNSYYQTYKNKGGSCYFKGAAMITELDPSHGSCQ | |||
| Full Sequence |
|---|
| Protein Sequence Length: 120 Download |
| MSTFLIRILL PLLIIAMTLP RRSEAESEQW CIADEQTPDD ELQAALDWAC GKGGADCSKM 60 QQENQPCFLP NTIRDHASFA FNSYYQTYKN KGGSCYFKGA AMITELDPSH GSCQYEYNP* 120 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 1.0e-17 | 29 | 102 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 1.0e-35 | 29 | 115 | 87 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003674 | molecular_function |
| GO:0008150 | biological_process |
| GO:0012505 | endomembrane system |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI28425.1 | 0 | 17 | 119 | 16 | 117 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_198423.1 | 0 | 1 | 119 | 1 | 119 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| RefSeq | XP_002321180.1 | 0 | 1 | 119 | 1 | 117 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002522909.1 | 0 | 3 | 119 | 2 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
| RefSeq | XP_002531703.1 | 0 | 1 | 109 | 1 | 107 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 0.00000000000004 | 20 | 115 | 3 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
