| Basic Information | |
|---|---|
| Species | Arabidopsis thaliana |
| Cazyme ID | AT5G63225.1 |
| Family | CBM43 |
| Protein Properties | Length: 111 Molecular Weight: 12087.7 Isoelectric Point: 4.4857 |
| Chromosome | Chromosome/Scaffold: 5 Start: 25356133 End: 25356740 |
| Description | X8 domain containing protein, expressed |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 25 | 106 | 4.2e-34 |
| WCMAMPNATGEQLQANIDYACSQNVDCTPIQPGGTCYEPNTLLDHASFAMNAYYQSHGRIEDACRFGRTGCFVFIDPSNGSC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 111 Download |
| MSSQLLTLFL LLSAVAIPVV TSRQWCMAMP NATGEQLQAN IDYACSQNVD CTPIQPGGTC 60 YEPNTLLDHA SFAMNAYYQS HGRIEDACRF GRTGCFVFID PSNGSCIYYT * 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 2.0e-24 | 24 | 94 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 9.0e-40 | 24 | 108 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0003674 | molecular_function |
| GO:0008150 | biological_process |
| GO:0012505 | endomembrane system |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAB10565.1 | 1e-36 | 12 | 88 | 13 | 89 | unnamed protein product [Arabidopsis thaliana] |
| DDBJ | BAB10565.1 | 0 | 22 | 110 | 90 | 178 | unnamed protein product [Arabidopsis thaliana] |
| RefSeq | NP_001078788.1 | 0 | 1 | 110 | 1 | 110 | unknown protein [Arabidopsis thaliana] |
| RefSeq | NP_200173.1 | 9.99995e-41 | 1 | 106 | 1 | 108 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
| RefSeq | NP_201128.2 | 0 | 12 | 110 | 13 | 111 | unknown protein [Arabidopsis thaliana] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 3e-25 | 16 | 108 | 1 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
