y PlantCAZyme

CAZyme Information

Basic Information
SpeciesAquilegia coerulea
Cazyme IDAquca_001_00320.1
FamilyGT66
Protein PropertiesLength: 785 Molecular Weight: 87554.3 Isoelectric Point: 9.3884
ChromosomeChromosome/Scaffold: 1 Start: 3317961 End: 3330705
Descriptionstaurosporin and temperature sensitive 3-like A
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66217150
  SLFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTLWWILNSLNIPLSVETVCVF
  TAPIFSAFAAWATYLLTKEVKGTGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYLKTLNTGSLFYATLNALSYFYMVCSWGGYTFIINL
  IPMHALLCIVTGRYSSRLYIAYAPLIVLGTLLASLVPVVGFNAVMTSEHFASFLVFIIIHVVALVYYIKGILTPKMFKVAVTLVVSVGMIVCFAMVAVLV
  ALVASSPTKGWSGRSLSLLDPTYASKYIPIIASVSEHQPPTWPSYFMDINVLAFLVPAGIIACFLPLSDASSFVVLYIVTSVYFSGVMVRLMLVLAPAAC
  ILSGIALSEAFDVFTRSIKCQLSDLLSDPLPAAGDMASENSAVQNDIVKVDKHSTAQKSDEGLKERTSKKNRKKEKEHVEKVSIKARKEKRLLVLPLETS
  VIAILLLVMLGAFYVVHCVWAAAEAYSAPSIVLTSHSHDGLHVFDDFREAYAWLSHNTEVDDKVASWWDYGYQTTAMANRTVIVDNNTWNNTHIATVGTA
  MSSPEKAAWEIFDSLDVKYVLVVFGGLVGYPSDDINKFLWMVRIGGGVFPHIKEPDYLRDGQYRIDSQATPTMLNCLMYKLSYYRFVETDGKGFD
Full Sequence
Protein Sequence     Length: 785     Download
MAELEIGKGS KLRYAFGNVL SLFILLLIGV LAFSIRLFSV IKYESVIHEF DPYFNYRVTQ    60
FLTKNGIYDF WNWFDDRTWY PLGRVIGGTV YPGLTLTAGT LWWILNSLNI PLSVETVCVF    120
TAPIFSAFAA WATYLLTKEV KGTGAGLTAA VLLAMVPSYI SRSVAGSYDN EAVAIFALIF    180
TFYLYLKTLN TGSLFYATLN ALSYFYMVCS WGGYTFIINL IPMHALLCIV TGRYSSRLYI    240
AYAPLIVLGT LLASLVPVVG FNAVMTSEHF ASFLVFIIIH VVALVYYIKG ILTPKMFKVA    300
VTLVVSVGMI VCFAMVAVLV ALVASSPTKG WSGRSLSLLD PTYASKYIPI IASVSEHQPP    360
TWPSYFMDIN VLAFLVPAGI IACFLPLSDA SSFVVLYIVT SVYFSGVMVR LMLVLAPAAC    420
ILSGIALSEA FDVFTRSIKC QLSDLLSDPL PAAGDMASEN SAVQNDIVKV DKHSTAQKSD    480
EGLKERTSKK NRKKEKEHVE KVSIKARKEK RLLVLPLETS VIAILLLVML GAFYVVHCVW    540
AAAEAYSAPS IVLTSHSHDG LHVFDDFREA YAWLSHNTEV DDKVASWWDY GYQTTAMANR    600
TVIVDNNTWN NTHIATVGTA MSSPEKAAWE IFDSLDVKYV LVVFGGLVGY PSDDINKFLW    660
MVRIGGGVFP HIKEPDYLRD GQYRIDSQAT PTMLNCLMYK LSYYRFVETD GKGFDRVRRT    720
EIGKKHFKLT HFEEVFTTHH WMVRIYKLKS PKNRVRGKTK KSKSKASSAA KLKKVDRGKK    780
NPWH*                                                                840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR04154archaeo_STT35.0e-1349600611+
COG1287COG12878.0e-6132756766+
pfam02516STT33.0e-11332708704+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC79544.10157843511119hypothetical protein OsI_20658 [Oryza sativa Indica Group]
RefSeqNP_001056068.1017841787Os05g0519900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002280521.104278442778PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002325019.104276345759predicted protein [Populus trichocarpa]
RefSeqXP_002514244.104278443779oligosaccharyl transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A053775920246A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.000015666826123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.000015666826123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.000015666826123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
1335
83105
112134
144166
173195
210232
239261
271288
301323
365387
392414
521543
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7788675382207570
HO4763975522107540
HO7969143653937570
HO7788671161072229e-31
HO796914203864052.7
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma09g29470.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1Phvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)