| Basic Information | |
|---|---|
| Species | Aquilegia coerulea |
| Cazyme ID | Aquca_003_00737.1 |
| Family | GH1 |
| Protein Properties | Length: 123 Molecular Weight: 13741.7 Isoelectric Point: 6.0724 |
| Chromosome | Chromosome/Scaffold: 3 Start: 8984464 End: 8985535 |
| Description | beta glucosidase 11 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 3 | 96 | 1.8e-25 |
| VKQKGVIGINLFSFACTPMTNSTADIEAARRATTFYTDWVMNPMVFGDYPETMKNIVGLRLPSFTQHESQLLKGSSDFIGMNHYFTLYIEDDPQ | |||
| Full Sequence |
|---|
| Protein Sequence Length: 123 Download |
| MQVKQKGVIG INLFSFACTP MTNSTADIEA ARRATTFYTD WVMNPMVFGD YPETMKNIVG 60 LRLPSFTQHE SQLLKGSSDF IGMNHYFTLY IEDDPQSTPG DFISDMGVKS SGLLHCYFKV 120 HI* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR03356 | BGL | 4.0e-12 | 7 | 108 | 102 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 3.0e-20 | 5 | 100 | 99 | + Glycosyl hydrolase family 1. | ||
| PLN02998 | PLN02998 | 4.0e-25 | 16 | 109 | 97 | + beta-glucosidase | ||
| PLN02849 | PLN02849 | 1.0e-28 | 4 | 108 | 109 | + beta-glucosidase | ||
| PLN02814 | PLN02814 | 4.0e-32 | 4 | 108 | 110 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAD82684.1 | 2e-35 | 2 | 122 | 17 | 138 | beta-primeverosidase-like protein [Oryza sativa Japonica Group] |
| GenBank | EEC72093.1 | 2e-34 | 2 | 116 | 252 | 368 | hypothetical protein OsI_05051 [Oryza sativa Indica Group] |
| GenBank | EEE55943.1 | 5e-34 | 2 | 116 | 252 | 368 | hypothetical protein OsJ_04646 [Oryza sativa Japonica Group] |
| RefSeq | NP_001045291.1 | 5e-34 | 2 | 112 | 251 | 362 | Os01g0930800 [Oryza sativa (japonica cultivar-group)] |
| Swiss-Prot | Q5JK35 | 6e-34 | 2 | 112 | 252 | 363 | BGL05_ORYSJ RecName: Full=Beta-glucosidase 5; Short=Os1bglu5; Flags: Precursor |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ptq_B | 2e-22 | 2 | 98 | 257 | 353 | X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa |
| PDB | 3ptq_A | 2e-22 | 2 | 98 | 257 | 353 | X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa |
| PDB | 3ptm_B | 2e-22 | 2 | 98 | 257 | 353 | X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa |
| PDB | 3ptm_A | 2e-22 | 2 | 98 | 257 | 353 | X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa |
| PDB | 3ptk_B | 2e-22 | 2 | 98 | 257 | 353 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FL511062 | 112 | 2 | 111 | 0 |
| DR933089 | 114 | 2 | 111 | 6.99949e-42 |
| DT746485 | 114 | 2 | 111 | 1.99993e-41 |
| DT754100 | 114 | 2 | 111 | 1.99993e-41 |
| DT760926 | 114 | 2 | 111 | 4.99997e-41 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Brassica rapa | Bra006217 | Bra020858 | |||
| Malus domestica | MDP0000310215 | ||||
| Medicago truncatula | Medtr8g038650.1 | ||||
| Prunus persica | ppb019447m | ||||
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |