| Basic Information | |
|---|---|
| Species | Aquilegia coerulea |
| Cazyme ID | Aquca_005_00256.1 |
| Family | CBM43 |
| Protein Properties | Length: 118 Molecular Weight: 13271 Isoelectric Point: 5.5342 |
| Chromosome | Chromosome/Scaffold: 5 Start: 2611393 End: 2612699 |
| Description | Carbohydrate-binding X8 domain superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| CBM43 | 29 | 112 | 1.8e-31 |
| WCIADEQTPDDVLQYALDWACSQKNVDSSKLQVNQPCFLPNTVRDHASYAFNSYYQNYKHKGASCYFNGAAMTTELDPSHGSCK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 118 Download |
| MLSVLQKLVL AILFVMAISQ KTDGQFQQWC IADEQTPDDV LQYALDWACS QKNVDSSKLQ 60 VNQPCFLPNT VRDHASYAFN SYYQNYKHKG ASCYFNGAAM TTELDPSHGS CKFEYIP* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam07983 | X8 | 3.0e-16 | 28 | 100 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
| smart00768 | X8 | 1.0e-34 | 28 | 113 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK92842.1 | 0 | 8 | 117 | 10 | 119 | unknown [Populus trichocarpa] |
| RefSeq | XP_002272918.1 | 0 | 1 | 117 | 1 | 118 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002307902.1 | 0 | 8 | 117 | 9 | 118 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002321180.1 | 0 | 1 | 117 | 1 | 117 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002522909.1 | 0 | 5 | 117 | 5 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2jon_A | 0.000000000000008 | 17 | 113 | 1 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
