Basic Information | |
---|---|
Species | Aquilegia coerulea |
Cazyme ID | Aquca_007_00839.2 |
Family | GT2 |
Protein Properties | Length: 213 Molecular Weight: 24495.6 Isoelectric Point: 9.9495 |
Chromosome | Chromosome/Scaffold: 7 Start: 6478907 End: 6484075 |
Description | Nucleotide-diphospho-sugar transferases superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT2 | 9 | 116 | 3.6e-37 |
SIIVPTYNERLNIALLVYLIFKHLKDVDFEIIVVDDGSPDGTQEVVKQLQKLYGEDRILLRARPRKLGLGTAYIHGLKHASGNFVVIMDADLSHHPKYLP SFIRYVRG |
Full Sequence |
---|
Protein Sequence Length: 213 Download |
MEKEKNKYSI IVPTYNERLN IALLVYLIFK HLKDVDFEII VVDDGSPDGT QEVVKQLQKL 60 YGEDRILLRA RPRKLGLGTA YIHGLKHASG NFVVIMDADL SHHPKYLPSF IRYVRGGGVH 120 GWNLMRKLTS RGANVLAQTL LWPGVSDLTG SFRYMTFHSL FFYNYYFHLI WCHLEANGTV 180 TNMPFLTGFT RDLSLRMLLT PVLVRDMSSR WK* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd04187 | DPM1_like_bac | 2.0e-27 | 10 | 156 | 157 | + Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily. | ||
pfam00535 | Glycos_transf_2 | 4.0e-29 | 9 | 160 | 167 | + Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids. | ||
cd04179 | DPM_DPG-synthase_like | 3.0e-51 | 10 | 153 | 159 | + DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily. | ||
cd06442 | DPM1_like | 3.0e-81 | 10 | 153 | 158 | + DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily. | ||
PLN02726 | PLN02726 | 6.0e-108 | 3 | 153 | 166 | + dolichyl-phosphate beta-D-mannosyltransferase |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_564118.1 | 0 | 3 | 153 | 10 | 174 | dolichyl-phosphate beta-D-mannosyltransferase, putative / dolichol-phosphate mannosyltransferase, putative / mannose-P-dolichol synthase, putative [Arabidopsis thaliana] |
RefSeq | XP_002285933.1 | 0 | 6 | 153 | 10 | 171 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002300644.1 | 0 | 1 | 153 | 1 | 168 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002307788.1 | 0 | 1 | 153 | 1 | 166 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002510671.1 | 0 | 4 | 153 | 3 | 166 | dolichol-phosphate mannosyltransferase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2z87_B | 0.000000001 | 9 | 112 | 95 | 196 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp- Galnac And Udp |
PDB | 2z87_A | 0.000000001 | 9 | 112 | 95 | 196 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp- Galnac And Udp |
PDB | 2z86_D | 0.000000001 | 9 | 112 | 96 | 197 | A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EX749332 | 166 | 2 | 153 | 0 |
EW717588 | 166 | 2 | 153 | 0 |
FD579067 | 204 | 2 | 191 | 0 |
EW722666 | 204 | 2 | 191 | 0 |
EY939447 | 203 | 2 | 190 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|