CAZyme Information

Basic Information
SpeciesAquilegia coerulea
Cazyme IDAquca_009_00935.1
FamilyAA1
Protein PropertiesLength: 274 Molecular Weight: 30512.1 Isoelectric Point: 8.3901
ChromosomeChromosome/Scaffold: 9 Start: 5631807 End: 5632924
Descriptionlaccase 17
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1602605.9e-31
  QYELLSLSHTSTKKHPLFRPRLPSLNDTSFVANLATSEFPANVPHNVDKQFFFTVALGTSPCPKNHTCQGPNGSMFAASINNISFALPTKALLQAHFPGQ
  SNGVYAPNFPSKPTIPFNYTGTPPNNTCAESHPLHLHGFNFFVIGQGFSNYDPTKDPTKFNLIDPLERNTIILVYHLVVGLQFVFCVWFMHCHLEVHTSW
  G
Full Sequence
Protein Sequence     Length: 274     Download
MNGGRVRNLS LGDALTLYFS RVKTKRQHPN ATFLMESWQL DLMLLVKEPS TILLPLVILQ    60
YELLSLSHTS TKKHPLFRPR LPSLNDTSFV ANLATSEFPA NVPHNVDKQF FFTVALGTSP    120
CPKNHTCQGP NGSMFAASIN NISFALPTKA LLQAHFPGQS NGVYAPNFPS KPTIPFNYTG    180
TPPNNTCAES HPLHLHGFNF FVIGQGFSNY DPTKDPTKFN LIDPLERNTI ILVYHLVVGL    240
QFVFCVWFMH CHLEVHTSWG IEDGMSCVGW KTP*                                300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02191PLN021915.0e-12138261156+
PLN02604PLN026046.0e-15160269117+
TIGR03388ascorbase5.0e-15138256153+
pfam07731Cu-oxidase_24.0e-1618426080+
TIGR03389laccase5.0e-7558261242+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAB17192.1022273282571laccase [Liriodendron tulipifera]
EMBLCAN60348.1022273257545hypothetical protein [Vitis vinifera]
EMBLCBI16224.1022273283571unnamed protein product [Vitis vinifera]
RefSeqXP_002520231.1022273279566laccase, putative [Ricinus communis]
RefSeqXP_002531824.1022273280562laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3sqr_A0.00000002191261463536A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution
PDB3v9e_A0.00000003191261463536A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada
PDB1asq_B0.00000005188269442529A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada
PDB1asq_A0.00000005188269442529A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada
PDB1asp_B0.00000005188269442529A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG176300253582730
JG213352243222300
CN550235229722620
FN753252248582620
HS254874219812620
Orthologous Group
SpeciesID
Brassica rapaBra005140.269.564Bra005140.269.564
Carica papayaevm.model.supercontig_19.218evm.model.supercontig_139.15.299.495evm.model.supercontig_169.17.281.510evm.model.supercontig_169.17.281.510evm.model.supercontig_139.15.299.495
Citrus sinensisorange1.1g047904morange1.1g008592m.269.548orange1.1g008592m.269.548
Glycine maxGlyma13g41310.1
Gossypium raimondiiGorai.009G103600.1.261.496Gorai.009G103600.1.261.496
Linum usitatissimumLus10013800Lus10004975
Malus domesticaMDP0000127409
Panicum virgatumPavirv00032912mPavirv00002681mPavirv00055389m
Phaseolus vulgarisPhvul.008G100600.1.286.504Phvul.008G100600.1.286.504
Picea abiesMA_502044g0010MA_9147880g0010MA_115430g0010MA_10430876g0010MA_10053838g0010
MA_9198822g0010MA_14240g0010
Prunus persicappa018465mppa017222mppa022262m
Sorghum bicolorSb03g028920.1
Vitis viniferaGSVIVT01034140001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny