| Basic Information | |
|---|---|
| Species | Aquilegia coerulea |
| Cazyme ID | Aquca_015_00031.1 |
| Family | GH1 |
| Protein Properties | Length: 110 Molecular Weight: 12616 Isoelectric Point: 9.2575 |
| Chromosome | Chromosome/Scaffold: 15 Start: 264837 End: 265988 |
| Description | beta glucosidase 5 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 4 | 97 | 2.9e-31 |
| GIPMNDDESSNPPTRNDTVRIDYLQGYVTSLLPSIRNGSNIRGYFVWSFLDCFEAMGGYTSHYGLYEVDFKNKDRKRYPRQSAQWYSNFLAKTG | |||
| Full Sequence |
|---|
| Protein Sequence Length: 110 Download |
| MKTGIPMNDD ESSNPPTRND TVRIDYLQGY VTSLLPSIRN GSNIRGYFVW SFLDCFEAMG 60 GYTSHYGLYE VDFKNKDRKR YPRQSAQWYS NFLAKTGRKT KTDSYLSGE* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| TIGR03356 | BGL | 4.0e-21 | 19 | 89 | 71 | + beta-galactosidase. | ||
| PLN02998 | PLN02998 | 4.0e-22 | 20 | 96 | 77 | + beta-glucosidase | ||
| pfam00232 | Glyco_hydro_1 | 2.0e-25 | 4 | 97 | 94 | + Glycosyl hydrolase family 1. | ||
| PLN02814 | PLN02814 | 9.0e-26 | 1 | 96 | 96 | + beta-glucosidase | ||
| PLN02849 | PLN02849 | 1.0e-26 | 1 | 93 | 93 | + beta-glucosidase | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAK07429.1 | 1e-24 | 7 | 98 | 442 | 533 | AF321287_1 beta-glucosidase [Musa acuminata] |
| EMBL | CAN81257.1 | 2e-24 | 3 | 103 | 296 | 394 | hypothetical protein [Vitis vinifera] |
| EMBL | CBI36851.1 | 3e-25 | 5 | 103 | 440 | 536 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI36856.1 | 4e-24 | 17 | 100 | 408 | 491 | unnamed protein product [Vitis vinifera] |
| EMBL | CBI36856.1 | 1e-21 | 19 | 103 | 884 | 968 | unnamed protein product [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ptq_B | 3e-18 | 20 | 95 | 431 | 505 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptq_A | 3e-18 | 20 | 95 | 431 | 505 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptm_B | 3e-18 | 20 | 95 | 431 | 505 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptm_A | 3e-18 | 20 | 95 | 431 | 505 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| PDB | 3ptk_B | 3e-18 | 20 | 95 | 431 | 505 | A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| JZ014480 | 110 | 1 | 110 | 0 |
| DR939012 | 109 | 2 | 110 | 0 |
| DR915581 | 109 | 2 | 110 | 0 |
| JZ020754 | 109 | 2 | 110 | 0 |
| DR922110 | 109 | 2 | 110 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |