y
Basic Information | |
---|---|
Species | Aquilegia coerulea |
Cazyme ID | Aquca_026_00111.3 |
Family | AA2 |
Protein Properties | Length: 138 Molecular Weight: 15083.3 Isoelectric Point: 9.4359 |
Chromosome | Chromosome/Scaffold: 26 Start: 702718 End: 704021 |
Description | ascorbate peroxidase 2 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 18 | 136 | 1.3e-36 |
KCKRKLRAFIAEKNCAPLMLRLAWHSAGTFDVKTKTGGPFGTMRHKAEQSHAANNGLDKAVVWLEPIKEQFPILSYGDFYQLAGVVAVEITGGPDVPFHP GRKDKDEPPLEGRLPDATK |
Full Sequence |
---|
Protein Sequence Length: 138 Download |
MGKSYPSVSE DYKKALDKCK RKLRAFIAEK NCAPLMLRLA WHSAGTFDVK TKTGGPFGTM 60 RHKAEQSHAA NNGLDKAVVW LEPIKEQFPI LSYGDFYQLA GVVAVEITGG PDVPFHPGRK 120 DKDEPPLEGR LPDATKG* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00141 | peroxidase | 2.0e-28 | 24 | 135 | 121 | + Peroxidase. | ||
PLN02608 | PLN02608 | 1.0e-64 | 6 | 137 | 132 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 7.0e-69 | 5 | 137 | 137 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN02364 | PLN02364 | 3.0e-73 | 1 | 137 | 137 | + L-ascorbate peroxidase 1 | ||
PLN02879 | PLN02879 | 9.0e-74 | 1 | 137 | 137 | + L-ascorbate peroxidase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAA86689.1 | 0 | 1 | 137 | 1 | 137 | ascorbate peroxidase [Nicotiana tabacum] |
GenBank | AAF22246.1 | 0 | 1 | 137 | 1 | 137 | ascorbate peroxidase [Pimpinella brachycarpa] |
GenBank | ACB45429.3 | 0 | 1 | 137 | 1 | 137 | ascorbate peroxidase [Camellia sinensis] |
DDBJ | BAA12918.1 | 0 | 1 | 137 | 1 | 137 | cytosolic ascorbate peroxidase [Nicotiana tabacum] |
EMBL | CAD33265.1 | 0 | 1 | 137 | 1 | 137 | ascorbate peroxidase [Crocus sativus] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1apx_D | 0 | 2 | 137 | 1 | 136 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_C | 0 | 2 | 137 | 1 | 136 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_B | 0 | 2 | 137 | 1 | 136 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 1apx_A | 0 | 2 | 137 | 1 | 136 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
PDB | 2xj6_A | 0 | 2 | 137 | 1 | 136 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
JZ002072 | 137 | 1 | 137 | 0 |
DR914769 | 137 | 1 | 137 | 0 |
DT768774 | 137 | 1 | 137 | 0 |
JZ004114 | 137 | 1 | 137 | 0 |
JG584646 | 137 | 1 | 137 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|