CAZyme Information

Basic Information
SpeciesAquilegia coerulea
Cazyme IDAquca_030_00024.1
FamilyGH13
Protein PropertiesLength: 952 Molecular Weight: 105260 Isoelectric Point: 6.1122
ChromosomeChromosome/Scaffold: 30 Start: 149170 End: 160818
Descriptionlimit dextrinase
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133507567.6e-29
  DSAGISHLKKLSKAGLTHVHLLPSFQFGGVNDEKDKWKYVDADKLAKLPPDSDEQQAQVAAIQDDDGYNWGYNPVLWGVPKGSYASNPNGSCRSLEFRKM
  VQSLNRIGLCVVLDVVYNHLHGSGPHDDNSVLDKVVPGYYLRRSTDGSIEHSTCVNNTASEHFMVERLILDDLHCWAVDYKVDGFRFDLMGHIMKSTMVK
  ANNALHSLSKDIHGVDGSKIYIYGEGWDFGEVANNGRGVNASQKNLYETQIGSFNDRIRDAILGGSPFGHPLQQGFVTGLSLQPNGHDHGAETVVDNMLA
  ASLDHIQIGMAANLRDFVLTSYQGEEMKGADILTYGGIPVAYASSPIETINYASAHDNETLFDIISLKTPIKISVDDRCRMNHLATSIVALSQGIPFFHC
  GDEMLRS
Full Sequence
Protein Sequence     Length: 952     Download
NNIAVLTKWW NYKHSNSLTS SFFSNRITIS SQSRSSSLKS LRCYSMLPVE QVSSPQEQQQ    60
QQQQQCEGNL LYSKAYWVTR SIIAWNVDVG DGSCFFYSSK TADLVLGNKG IEGQDVKIKL    120
EPVNGGLPAS VVEKFPHIQD YRVLKVPNDV DIKSLLKSQL AVALFNSNGE CSDATGLQLP    180
GVLDDLYSYH GPLGAVFSRD TVSLYLWAPT AHAVSACIYG VSSGGIPLET VQLEEVNGVW    240
SVDGPRSWEG CYYVYAVSVF HPSTLKIETC IANDPYARGL SSDGRRTLLI NLDCDNLKPE    300
GWEKLADEKP ELFAFSDISI YELHIRDFSA NDHTVNSDFQ GGYLAFTCKD SAGISHLKKL    360
SKAGLTHVHL LPSFQFGGVN DEKDKWKYVD ADKLAKLPPD SDEQQAQVAA IQDDDGYNWG    420
YNPVLWGVPK GSYASNPNGS CRSLEFRKMV QSLNRIGLCV VLDVVYNHLH GSGPHDDNSV    480
LDKVVPGYYL RRSTDGSIEH STCVNNTASE HFMVERLILD DLHCWAVDYK VDGFRFDLMG    540
HIMKSTMVKA NNALHSLSKD IHGVDGSKIY IYGEGWDFGE VANNGRGVNA SQKNLYETQI    600
GSFNDRIRDA ILGGSPFGHP LQQGFVTGLS LQPNGHDHGA ETVVDNMLAA SLDHIQIGMA    660
ANLRDFVLTS YQGEEMKGAD ILTYGGIPVA YASSPIETIN YASAHDNETL FDIISLKTPI    720
KISVDDRCRM NHLATSIVAL SQGIPFFHCG DEMLRSKSLD RDSYNSGDWF NRIDFTYESN    780
NWGVGLPPKG KNEKSWPLIK PRLADPSFKP NKGHILAAVE NFLNLLRIRY SSPLLRLRTA    840
NAIQKRVQFH NTGPSWVPGL IVMSIEDGHE GMPGLPQLDP VYSYIVVAFN ACPNEVLFTS    900
PVLQARSLQL HPIQLMSSDE LVKKSKYDAS NGSFTLPPRT SSVFVETRAT D*            960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1523PulA1.0e-87185944801+
TIGR02104pulA_typeI1.0e-131184901731+
cd11341AmyAc_Pullulanase_LD-like3.0e-163317781475+
PLN02877PLN02877067948882+
TIGR02103pullul_strch070948912+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAA58803.106394877962pullulanase [Spinacia oleracea]
EMBLCBI31395.106594871954unnamed protein product [Vitis vinifera]
RefSeqXP_002271820.106794824905PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315334.10479481893predicted protein [Populus trichocarpa]
RefSeqXP_002532780.103094851964pullulanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4aio_A0739486883A Chain A, Metallo-Carboxypeptidase From Pseudomonas Aeruginosa
PDB2y5e_A0739486883A Chain A, Metallo-Carboxypeptidase From Pseudomonas Aeruginosa
PDB2y4s_A0739486883A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2fhf_A0739441771066A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2fhc_A0739441771066A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT7301142772174930
EH7738472826058860
GO8722433415749140
AM7334102876259110
DT730114194905081.3
Orthologous Group
SpeciesID
Arabidopsis lyrata487216
Arabidopsis thalianaAT5G04360.1
Brachypodium distachyonBradi5g00540.2Bradi5g00540.1
Brassica rapaBra009461
Carica papayaevm.model.supercontig_53.158
Capsella rubellaCarubv10000153m
Chlamydomonas reinhardtiiCre11.g476650.t1.3
Citrus clementinaCiclev10031035m
Citrus sinensisorange1.1g002079morange1.1g002161morange1.1g002787m
Cucumis sativusCucsa.308730.1
Eucalyptus grandisEucgr.G02746.1Eucgr.G02746.2
Fragaria vescamrna23425.1-v1.0-hybrid
Glycine maxGlyma10g34080.1
Gossypium raimondiiGorai.009G305300.12Gorai.009G305300.11Gorai.009G305300.1Gorai.009G305300.10Gorai.009G305300.2
Gorai.009G305300.3Gorai.009G305300.4Gorai.009G305300.5Gorai.009G305300.6Gorai.009G305300.7
Gorai.009G305300.9Gorai.009G305300.8
Linum usitatissimumLus10038675
Malus domesticaMDP0000142103
Manihot esculentacassava4.1_004771m
Mimulus guttatusmgv1a001246m
Physcomitrella patensPp1s142_79V6.1.481.888
Phaseolus vulgarisPhvul.007G139400.1
Populus trichocarpaPotri.010G229300.4Potri.010G229300.1Potri.010G229300.2Potri.010G229300.3
Prunus persicappa000905m
Ricinus communis29475.m000230
Setaria italicaSi011852m
Selaginella moellendorffii165275
Sorghum bicolorSb06g001540.1
Thellungiella halophilaThhalv10012585m
Vitis viniferaGSVIVT01016183001
Volvox carteriVocar20014607m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny