Basic Information | |
---|---|
Species | Aquilegia coerulea |
Cazyme ID | Aquca_035_00227.1 |
Family | GH32 |
Protein Properties | Length: 159 Molecular Weight: 17990.2 Isoelectric Point: 6.2677 |
Chromosome | Chromosome/Scaffold: 35 Start: 2083153 End: 2083800 |
Description | Glycosyl hydrolases family 32 protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH32 | 13 | 119 | 2.6e-21 |
VKHVLKASLDDGKNDYYALGSYDIKKDVWNPDNPELDVGIGLRYDYGKFYASKTFYDQNKHWRILWGWTGETDSEYADVKKGWASLQTVPRVVVFDHKTK TNVLQWP |
Full Sequence |
---|
Protein Sequence Length: 159 Download |
MNGLDTSVNG PEVKHVLKAS LDDGKNDYYA LGSYDIKKDV WNPDNPELDV GIGLRYDYGK 60 FYASKTFYDQ NKHWRILWGW TGETDSEYAD VKKGWASLQT VPRVVVFDHK TKTNVLQWPV 120 EEVESLRSNK REFNKVKLGA GSIVPLDVGR ASQVCDFL* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
TIGR01322 | scrB_fam | 3.0e-9 | 17 | 132 | 121 | + sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]. |
COG1621 | SacC | 1.0e-9 | 41 | 154 | 117 | + Beta-fructosidases (levanase/invertase) [Carbohydrate transport and metabolism] |
cd08996 | GH32_B_Fructosidase | 6.0e-18 | 10 | 122 | 120 | + Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller. |
pfam00251 | Glyco_hydro_32N | 3.0e-34 | 4 | 119 | 122 | + Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure. |
smart00640 | Glyco_32 | 6.0e-43 | 7 | 157 | 154 | + Glycosyl hydrolases family 32. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAB47172.1 | 0 | 2 | 154 | 338 | 490 | vacuolar invertase 2, GIN2 [Vitis vinifera=grape berries, Sultana, berries, Peptide, 664 aa] |
GenBank | ABI17894.1 | 0 | 2 | 154 | 263 | 415 | vacuolar invertase [Coffea canephora] |
EMBL | CBI31885.1 | 0 | 2 | 154 | 145 | 297 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002272774.1 | 0 | 2 | 154 | 278 | 430 | PREDICTED: similar to vacuolar invertase 2, GIN2 isoform 1 [Vitis vinifera] |
RefSeq | XP_002272809.1 | 0 | 2 | 154 | 191 | 343 | PREDICTED: similar to vacuolar invertase 2, GIN2 isoform 2 [Vitis vinifera] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3ugh_B | 0 | 3 | 154 | 225 | 376 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 3ugh_A | 0 | 3 | 154 | 225 | 376 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 3ugg_B | 0 | 3 | 154 | 225 | 376 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 3ugg_A | 0 | 3 | 154 | 225 | 376 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 3ugf_B | 0 | 3 | 154 | 225 | 376 | A Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR922887 | 154 | 1 | 154 | 0 |
JZ006248 | 154 | 1 | 154 | 0 |
JZ000784 | 154 | 1 | 154 | 0 |
JZ002026 | 156 | 1 | 154 | 0 |
DR928909 | 154 | 1 | 154 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |