Basic Information | |
---|---|
Species | Aquilegia coerulea |
Cazyme ID | Aquca_057_00054.1 |
Family | CBM43 |
Protein Properties | Length: 122 Molecular Weight: 12921.3 Isoelectric Point: 4.7319 |
Chromosome | Chromosome/Scaffold: 57 Start: 617618 End: 618298 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 33 | 116 | 2.3e-35 |
WCVARPGATESALQVALDWACGQGKTDCNPIKPRGVCFEPNTLLSHASYAFNRYYQENGNSDIACNFGGTAIVTKHNPSYGKCN |
Full Sequence |
---|
Protein Sequence Length: 122 Download |
MVAGVEEKAE STIPIPSLSP PEGNTTFLDG TTWCVARPGA TESALQVALD WACGQGKTDC 60 NPIKPRGVCF EPNTLLSHAS YAFNRYYQEN GNSDIACNFG GTAIVTKHNP SYGKCNYSSP 120 D* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 6.0e-23 | 32 | 104 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 4.0e-41 | 32 | 117 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACJ85566.1 | 0 | 5 | 120 | 27 | 144 | unknown [Medicago truncatula] |
GenBank | ACU17215.1 | 0 | 5 | 119 | 26 | 140 | unknown [Glycine max] |
EMBL | CBI30973.1 | 0 | 5 | 119 | 574 | 688 | unnamed protein product [Vitis vinifera] |
GenBank | EAZ02781.1 | 0 | 6 | 117 | 29 | 140 | hypothetical protein OsI_24906 [Oryza sativa Indica Group] |
RefSeq | NP_001144702.1 | 0 | 6 | 117 | 31 | 142 | hypothetical protein LOC100277738 [Zea mays] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 7e-25 | 32 | 119 | 12 | 98 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
JK984738 | 115 | 5 | 119 | 0 |
DT019806 | 119 | 1 | 119 | 0 |
DT039619 | 119 | 1 | 119 | 0 |
DT019261 | 119 | 1 | 119 | 0 |
FK001098 | 115 | 5 | 119 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|