Basic Information | |
---|---|
Species | Aquilegia coerulea |
Cazyme ID | Aquca_069_00063.1 |
Family | GH3 |
Protein Properties | Length: 132 Molecular Weight: 14851.2 Isoelectric Point: 7.5021 |
Chromosome | Chromosome/Scaffold: 69 Start: 1132225 End: 1135185 |
Description | beta-xylosidase 1 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH3 | 9 | 78 | 2.7e-24 |
LTFWSPNVNIFRDPRWGHGQETPGEDPVLAGKYAASYVRGLQGYGGNPLKVAACCKHYTADELDNWNGVD |
Full Sequence |
---|
Protein Sequence Length: 132 Download |
MYNWGDAGLT FWSPNVNIFR DPRWGHGQET PGEDPVLAGK YAASYVRGLQ GYGGNPLKVA 60 ACCKHYTADE LDNWNGVDAS TLMPRLANKT FRIPLMFHLE TVFWKEKLPL LCVLPVLTLI 120 FYLIHQRVPE A* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PRK15098 | PRK15098 | 7.0e-10 | 12 | 88 | 82 | + beta-D-glucoside glucohydrolase; Provisional | ||
COG1472 | BglX | 7.0e-12 | 12 | 66 | 56 | + Beta-glucosidase-related glycosidases [Carbohydrate transport and metabolism] | ||
pfam00933 | Glyco_hydro_3 | 1.0e-18 | 12 | 69 | 58 | + Glycosyl hydrolase family 3 N terminal domain. | ||
PLN03080 | PLN03080 | 5.0e-33 | 1 | 76 | 85 | + Probable beta-xylosidase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACD93208.1 | 6e-40 | 1 | 120 | 142 | 269 | beta xylosidase [Camellia sinensis] |
RefSeq | XP_002270249.1 | 8e-40 | 1 | 95 | 143 | 241 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002302759.1 | 8e-40 | 1 | 95 | 141 | 239 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002316021.1 | 2e-38 | 1 | 95 | 142 | 240 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002320310.1 | 7e-39 | 1 | 78 | 11 | 88 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3u4a_B | 0.000000003 | 12 | 91 | 128 | 210 | A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose. |
PDB | 3u4a_A | 0.000000003 | 12 | 91 | 128 | 210 | A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose. |
PDB | 3u48_B | 0.000000003 | 12 | 91 | 128 | 210 | A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose. |
PDB | 3u48_A | 0.000000003 | 12 | 91 | 128 | 210 | A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose. |
PDB | 2x42_A | 0.0000001 | 13 | 69 | 117 | 168 | A Chain A, Structure Of Beta-Glucosidase 3b From Thermotoga Neapolitana In Complex With Alpha-D-Glucose |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DT762288 | 132 | 1 | 132 | 0 |
DR933469 | 102 | 2 | 103 | 0 |
EC953737 | 99 | 1 | 95 | 9.99967e-42 |
FS949698 | 86 | 1 | 86 | 9.99967e-42 |
DR933469 | 31 | 102 | 132 | 2.2 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|